KEGG   Lysinibacillus sphaericus: Bsph_4062Help
Entry
Bsph_4062         CDS       T00656                                 

Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bsph_4062
  Lipid metabolism
   00071 Fatty acid degradation
    Bsph_4062
Enzymes [BR:lsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bsph_4062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3931596..3932348)
Genome map
AA seq 250 aa AA seqDB search
MEDGVANITIARPPANALSRGIIAEVNSVLDAVEHDDAVRVLVLHGEGRFFSAGADIKEF
NGVESGEEFTKLASNGQQVFERVESFPKPVIAAIHGAALGGGLELAMSCHMRFVTESAKL
GLPELQLGLIPGFGGTQRLPRYVGVAKAAEMMFTSEPISGTEAVQWGLANRAFSEETLLE
ETLKIAKNIAKKSPIALKAAIQTLQYAKHASFYEGIDAEAKSFGTVFVTEDAKEGIQAFI
EKREPMFTGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatggggtagcaaatattacaattgcacgtccgccagcaaatgcgttatcacgc
ggtattattgcagaagtaaattctgtgctagatgctgtagaacatgatgatgctgtaaga
gtccttgtacttcatggtgaaggccgtttcttctctgcaggtgcagatattaaagaattt
aatggggtagaatctggagaagagttcacgaagctagctagcaatggacagcaagtattt
gagcgtgtggaatcgttccctaagccagttatcgcagctattcatggtgcagcattaggc
ggtgggcttgagctagcaatgagctgtcatatgcgctttgttacggaatcagcgaaacta
ggtttaccagagttacaattaggtcttattcctggctttggcggtacacagcgattacca
cgttatgttggtgtagcaaaggctgctgaaatgatgtttacgagcgaaccgatttctggt
acagaagctgtgcaatggggcttagcaaaccgtgcattctcagaagagacacttttagag
gaaacgctaaaaattgcaaagaatattgcaaagaagagtccaattgctttgaaggcagct
attcaaacattgcaatatgcaaagcatgcttcattttatgaaggtattgatgcggaagca
aaatcctttggtacagtgttcgtcacagaagatgcaaaagaaggaattcaagcattcatt
gaaaagcgtgagcctatgtttactggcaaataa

DBGET integrated database retrieval system