KEGG   Lysinibacillus sphaericus: Bsph_4225Help
Entry
Bsph_4225         CDS       T00656                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bsph_4225
Enzymes [BR:lsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Bsph_4225
Peptidases [BR:lsp01002]
 Cysteine Peptidases
  Family C44
   Bsph_4225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4098376..4100223)
Genome map
AA seq 615 aa AA seqDB search
MCGFIGYINGTNVIDHHQTIENMMNTIIHRGPDSGGIHSDDTVTLGFRRLSIIDLSDVAN
QPLYSEDGNIVLVFNGEIFNFQELRADLIEKGHTFKTQSDSEVIIYGYVEYGVDFVKKLR
GMFAFCIWDKKNDLQFIARDGFGIKPLYYSEHTTDGTFIFGSEIKSFLPHPSFIKELNKK
ALRPYLTFQYSSMDETFFKGVFKLPPAHYMLIQNGKKQIVQYWDKKFHAKEASIEKYIEE
IRTTVKESVEAHKISDVKVGSFLSGGIDSSYITSLLRPDKSFSVGFADYEDMFNETNLAK
DLSDTLNIQNERKYITADECFEALPKIQWHMDEPQSNPSSVPLYFLSELASKDVTVVLSG
EGADEIFGGYSWYQNSGRMQKYEKLPWGVRKTLRGIAEALPKSQYTNFLIKGGQTVEERF
IGEAVVWDEVDAINVLKPDYKNAPSVKSITKRIYDEVPGEDDVTKMQYLDLNLWMPGDIL
LKADKMSMAHSIELRVPFLDKEVMELAKNIPSQYRVNDIDTKYVLRQAAHQELPEEWAKR
PKLGFPVPIRHWLREEKYYNMVKEMFTTDFANEFFDTKQLVGYLDEHYEGKANRGRYIWT
AYVFLVWYKKFFVDM
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttataggttatattaatggaacaaatgtgattgatcatcatcaaacaatt
gaaaatatgatgaatacaattattcaccgcgggccagatagtggtggtattcatagtgac
gatacagtaacgttaggattcagacgattaagtattattgatttatcggatgtagcgaat
caaccactatatagtgaagacggcaatattgtgcttgtatttaatggagaaatttttaat
ttccaagagctacgtgcagatctgattgaaaaaggacatacctttaaaacgcaatcagat
agtgaagttattatttatggttatgtagaatacggtgtagattttgtgaaaaagctacgt
ggtatgtttgctttctgtatttgggataaaaagaatgatttacaattcattgctcgtgat
ggctttggcattaaaccattgtattactctgaacatacaacagacggtacgtttattttt
ggttctgaaattaaatcatttttaccacatccttcatttattaaagaattaaataaaaag
gcattacgtccttatttaacattccaatattcttcgatggatgagaccttctttaaaggg
gtctttaaattaccaccagcacactatatgcttattcaaaatggcaaaaagcaaattgtg
caatattgggataaaaaattccatgcaaaagaagcttccattgaaaaatacattgaagaa
attcgtacaactgttaaagaatcagtagaggcacataaaatcagtgatgtaaaagttggt
tctttcttatcggggggtattgactcaagttatattacttcattattgcgtcccgataaa
tcattctcagttgggtttgctgattatgaagatatgtttaatgaaacgaacctcgcaaaa
gatttatcggatacactaaatattcaaaatgaacgtaaatatattacagcagacgagtgc
tttgaagctcttccgaaaatccaatggcatatggatgagccgcaatcgaatccttcttct
gtaccactgtacttcctttcagagctagcctctaaagatgtaacagttgtcctatcaggt
gaaggagcggatgaaatttttggtggctactcttggtatcaaaactcaggaagaatgcaa
aaatatgaaaaacttccatggggtgttcgtaaaacgttacggggaatagcagaagctcta
cctaaaagccaatatactaacttcctcattaaaggtggtcaaacggtagaagaacgcttt
ataggagaagcagtagtttgggatgaagtagatgcgattaatgttttaaagcctgactat
aaaaatgcaccatctgtaaaatcgattacaaaacgtatttatgacgaagtaccaggcgaa
gatgatgtgacgaaaatgcaatacttagatttaaatctttggatgccaggagatatttta
ttaaaagctgacaagatgagtatggcgcattcgattgaattacgtgtaccattcttagat
aaagaagttatggaattagctaaaaatattccatctcaatatcgtgtcaacgacattgat
acaaaatatgttctacgccaagctgcacatcaagaattaccagaagaatgggcaaaacgt
ccaaagttaggcttcccagtgccaattcgccactggttgcgtgaagagaaatactacaat
atggtaaaagaaatgtttacaactgactttgccaatgaattctttgatacaaaacaattg
gttggctatctagatgaacactatgaaggaaaagcaaaccgtggccgttatatttggaca
gcctatgtattcctagtatggtataaaaagttctttgtggacatgtaa

DBGET integrated database retrieval system