KEGG   Lysinibacillus sphaericus: Bsph_4242Help
Entry
Bsph_4242         CDS       T00656                                 

Definition
sulfate transporter ychM
Orthology
K03321  
sulfate permease, SulP family
Organism
lsp  Lysinibacillus sphaericus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4121515..4123293)
Genome map
AA seq 592 aa AA seqDB search
MLCLLLGREDLSMKSLFTGRFEGYSVHHAKKDLLSGIIVGIVAIPLAMSFAIASGVKPEY
GIYTACIAGILISIFGGSKYQIGGPTGAFVPILLGIVLTYGYEDLLLAGLMAGVLLCLMG
IFKLGTLIKFIPRPVTIGFTAGIAVIIFTGQIANFLGLSNMTRHEYFIANIQEIGKQIGT
TNIYSILTAVICLITIIMTPKFFPKVPGALVGIVVSTLVATFFFSGQVATIATAYGQIPN
TLPNFALPTMTFERLQQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNRELIGQGIA
NIVTPMFGGIPATGAIARTATNIKTGAVSPMSGIIHGVFVLLTLLLLAPYASHIPLASMA
PVLMVVAWNMSERKHFSHIIKLKSGDSLVLLITFLLTVFTSLTLAVEVGLVLAVLLFAKR
MSEKLVVTKVLPDHSNKSEKVQPHVVHQQHDCPQISMYTIEGPLFFGAAQRFEQMIEGTL
QQRPRVLILRMGKVPFMDSTGEAYFSNIIDNFTAQGGNILVTGVQDDLKVALQQNGLYAK
IGAHHFYQHTGEAISRALNYLDRTQCIGCQHFAFHECKDLSKSEEKKDLIVQ
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcttattattgggaagggaagatttatctatgaagtcgctgtttacaggacgt
tttgaagggtattcagtccatcatgctaaaaaggatttattgtctggaatcattgttgga
attgttgctattccacttgctatgtcctttgctattgcatcaggagtaaagcccgaatat
ggcatttatacggcttgtattgcaggtattctgatttcaatttttggtggatcaaagtat
caaattggagggcccacaggagcttttgtgccaattcttttaggaattgtcctaacgtat
ggctatgaggatttattactggctggtttaatggcaggggtattgctttgcttaatgggt
atttttaagctagggactttaatcaaatttatccctcgccctgtaaccatcggttttaca
gcgggtatagcggtgattatttttacaggtcaaattgccaattttttaggtttaagcaat
atgacaagacatgagtattttatagcgaatattcaagagataggaaagcaaattggtact
actaatatttacagtattttaacggcagtcatttgtttaatcaccataataatgacacct
aaattttttccaaaggttcccggggcattggtagggattgttgtctccactcttgtggcg
actttctttttttcaggacaagtggctacgattgccacagcctatggtcaaatacctaat
acattacccaattttgcactacctactatgacatttgagcgtctacagcagctcattgga
ccagcatttgtcatcgcaatgcttggaggtatagagtctttgttatctgcagtcgtggca
gatggaatgactaatagcaagcataatagtaatcgagagctaatcggacaaggaattgcc
aatatcgtaacgcctatgtttggaggaatacccgcgacaggtgcgattgctcgtacagca
actaatattaaaactggggcagtatccccaatgtctggtatcatccatggtgtgtttgta
ttacttacattattgttattagcgccatatgcttcacatatacctttagcaagtatggca
ccagtattaatggtagttgcttggaatatgagtgaacggaagcatttttctcatattata
aagttgaaatctggagattcgcttgttttattaattacctttttattaaccgtatttact
agccttacattagctgttgaagtggggcttgtgttagccgtgctattatttgcgaagcga
atgagtgaaaagcttgttgtgacaaaggtactgccagatcattcgaataaaagtgagaag
gtacagcctcatgtcgttcatcaacagcatgattgtccacaaataagcatgtataccatc
gaaggtccgctgttctttggtgcagcacaaagatttgaacaaatgattgaaggcacctta
caacagcgaccaagagttttgatattacgcatggggaaagtgccctttatggactctaca
ggggaagcatattttagcaatattatagacaactttacagcacagggaggtaatattttg
gtaacaggggtgcaggatgacctaaaggttgcccttcagcaaaatggtctttacgctaaa
ataggagcacatcatttttatcagcatacaggagaagcgatttcaagagccctcaactat
ttggacagaactcaatgtatcggatgtcagcattttgcttttcatgaatgcaaagattta
tcaaaatctgaggaaaaaaaggatttaattgttcagtaa

DBGET integrated database retrieval system