KEGG   Lysinibacillus sphaericus: Bsph_4349Help
Entry
Bsph_4349         CDS       T00656                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bsph_4349
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bsph_4349
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bsph_4349
Enzymes [BR:lsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bsph_4349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4229166..4230245
Genome map
AA seq 359 aa AA seqDB search
MRTKGDHIFMWKGLIEEYKQFLPVTENTPALTLNEGNTPLIHLVNLSKKLGIELYGKIEG
ANPTGSFKDRGMVFAVAKAIEDGSKCVICASTGNTSAAAAAYATRAGIQSIVVIPKGKVA
LGKLAQATMYGAKIIEIDGNFDDALSIVRQVSETTPVALVNSVNPYRIEGQKTASFEIVD
ALGSAPDYLCIPVGNAGNITAYWKGFKEYHAAKDSGLPKMYGFEAEGAAAIVKGEPIANP
ETVATAIRIGNPASWKLAEAARDESGGIIDSVTDQEIIAAYKLIANTEGIFVEPGSAASL
AGVIKSVESGKIPMGSKVVTIFTGNGLKDPDTAMDVSTVEVVSLKNDENEIREYIEGIL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaaaggagatcatatctttatgtggaaaggccttattgaagaatataaacaa
tttttacctgtaacagaaaatacacctgcattaactttaaacgaaggcaatacgcctctt
atacatttagtgaatttatccaagaaattaggcattgagctttacggtaaaattgagggt
gcaaacccaaccggctcttttaaagaccgtggtatggtatttgcagtggccaaagctatt
gaagatggtagtaaatgtgttatttgtgcctcaacaggaaatacatctgctgctgcagct
gcttatgctacaagagctggtattcaatccatcgttgtaattcctaaaggaaaagttgcc
cttggtaagcttgcacaagcaactatgtatggtgcaaaaatcattgagattgacggtaac
tttgatgatgctttaagtattgttcgccaagtaagtgaaacaactcctgtcgctcttgtc
aactccgtcaatccataccgcattgaaggtcaaaaaactgcatcatttgagattgtagat
gccttaggctcagctcctgattatctatgcatcccagttggaaatgcagggaatattact
gcttactggaagggctttaaagaatatcatgctgctaaagattctggtctacccaagatg
tatggctttgaagctgaaggtgcagcagcaatcgtcaaaggagagcccattgccaatcca
gagacagttgccactgctattcgaattggtaatccagctagctggaaattggcagaagca
gctcgagatgaatctggaggtataattgactccgtaacggatcaagaaattattgcagct
tataagttaatcgcaaatacagaaggtattttcgttgaaccagggtctgctgcatcatta
gcaggtgttattaaatcggtggaaagcggaaaaattccaatgggttcaaaagtagtgaca
atcttcacaggtaatggactaaaagatcctgatacagccatggatgtatccacagtagaa
gtagtatcccttaaaaatgatgaaaatgaaattcgagaatatatcgagggaatactatga

DBGET integrated database retrieval system