KEGG   Lysinibacillus sphaericus: Bsph_4402Help
Entry
Bsph_4402         CDS       T00656                                 

Definition
glutathione peroxidase-like protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bsph_4402
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bsph_4402
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bsph_4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4279770..4280315)
Genome map
AA seq 181 aa AA seqDB search
MSIYNYLVRKPNGEILSMETFRGKTLLIVNTANQCRFTYQFEDLQKMYDKYGKNNFVVLG
FPCDQFGHQNPEDGEETAHLCKVNYGVTFPIFELIQVNGETTHPLFNYLKHEVDFREFGK
ASMQEKMLAEAIVQFAPSFLDGRNIRWNFTKFLVDASGKTVARFEPTDSQLDIEQAIEKV
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttataattatttagtacgaaagccgaatggtgaaattttatcaatggaaaca
tttcgcggtaaaacattgctaatagttaatacagctaatcagtgccgatttacatatcaa
tttgaagacttacaaaaaatgtacgataaatatggaaaaaataattttgtcgttctaggt
tttccttgcgatcaatttggccaccaaaatccagaagatggagaggaaactgcgcatctt
tgtaaagtaaactacggagttacgttccccatttttgagcttatccaagtaaatggtgag
acgacacatcctttatttaattatttaaaacatgaagtcgatttccgtgaattcgggaaa
gcaagcatgcaggagaaaatgctggctgaggcgatcgttcaatttgctccaagtttctta
gatggtcgaaatattcgctggaattttactaaatttttagtagatgcaagcggaaaaacc
gtagctcgctttgagcctacagactcacagcttgatattgagcaagcaattgaaaaagta
ttatag

DBGET integrated database retrieval system