KEGG   Lysinibacillus sphaericus: Bsph_4468Help
Entry
Bsph_4468         CDS       T00656                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_4468
   01230 Biosynthesis of amino acids
    Bsph_4468
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_4468
  Energy metabolism
   00680 Methane metabolism
    Bsph_4468
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bsph_4468
Enzymes [BR:lsp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bsph_4468
Exosome [BR:lsp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bsph_4468
  Exosomal proteins of melanoma cells
   Bsph_4468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4335613..4336224)
Genome map
AA seq 203 aa AA seqDB search
MIWDYLMTYYSNKTTFSRREAFMSNIYVIRHCLAQGQSPDAPLTQTGMRQADSLADFFKD
TTIHRILSSPFLRAVQSIEAISKEKGIQIEIDHRLSERLLSTKDLPDWYEKLQATFMDMD
LSFDGGESSKEAMDRIVNVVEEAVARNVENTLLVSHGNIITLLLKHYNKDIDFQCWKDLS
NPDVFVLQVKHNNIVIERVWNPQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggattatttaatgacgtactattctaataaaactactttttcaagacgagag
gcatttatgagtaatatctatgtcattagacattgtcttgcacaagggcaatcacctgac
gcccctttaacacagacaggcatgaggcaagcagatagcttagctgattttttcaaagat
actaccattcatcgaattctctcaagcccctttttacgcgcagtccaatccattgaagct
atcagtaaagaaaagggtattcaaattgaaatagatcatcgattgtctgaacgactttta
agtacaaaagatttgccagattggtacgaaaaattacaggcaacatttatggatatggac
ttatcatttgatgggggagaatccagcaaagaagcaatggaccgcattgtgaatgttgta
gaggaggctgttgctcgaaatgttgaaaataccttactagtgagtcatggcaatatcatc
accttattattgaaacattataataaagatattgattttcaatgttggaaagatttaagt
aatccagatgtttttgtattacaggtaaagcacaataacatcgtaatagaacgggtatgg
aatccacagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system