KEGG   Lysinibacillus sphaericus: Bsph_4572Help
Entry
Bsph_4572         CDS       T00656                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00010  Glycolysis / Gluconeogenesis
lsp00620  Pyruvate metabolism
lsp00640  Propanoate metabolism
lsp00680  Methane metabolism
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01120  Microbial metabolism in diverse environments
lsp01130  Biosynthesis of antibiotics
lsp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_4572
   00620 Pyruvate metabolism
    Bsph_4572
   00640 Propanoate metabolism
    Bsph_4572
  Energy metabolism
   00680 Methane metabolism
    Bsph_4572
Enzymes [BR:lsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bsph_4572
Lipid biosynthesis proteins [BR:lsp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bsph_4572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACA42018
UniProt: B1HMU0
Position
4426361..4427938
Genome map
AA seq 525 aa AA seqDB search
MVIKDLIAPDVYNITEELEKFSQDSERQAIRWLNTQQERQTVTYVELVQKMNQYANAFTK
KGLQKGDRVLVIIPRLPEAYFVFLGCLKAGIVPISCSEMLRASDLEYRMEHSSASAVIAY
EAFTSEVDKISSSVNTLKNKMVIGTATGDWSSLDELASSQPNTFTAVATKRDDMAFLSYT
SGTTGKPKGVVHSHGWGYAHIRTAAAQWLCVREGDLVWATAAPGWQKWIWSPFLSTIMLG
ATAFVYHGGFDAKTYLRLLQDEKINVLCCTPTEYRIMAKLENLKDYNLSSLRSAVSAGEP
LNRPVIETFKNHFDLKVRDGYGQTENTLLIGTLENTELRPGSMGVPTPGNIVRIIDNEGN
EAPVGEVGDIAIHKSSPALFKEYYREPERTQAAFRGEWYITGDQAKCDEDGYFWFEGRGD
DIIISSGYTIGPFEVEDALNKHDAVQECAVVAAPDEIRGHIVKAYVILRDGYKEHNEEEL
IKELQEHVKALTAPYKYPRSIVFIDELPKTTSGKIRRIELRAATV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtaataaaggatttaattgcaccggatgtttataacattacagaggaattagaaaaa
ttttcgcaagatagtgaacgccaagctatacgttggttaaatacacaacaagagaggcaa
acagttacttacgtagagcttgttcaaaaaatgaatcaatacgctaatgcctttacgaag
aaggggcttcaaaaaggagatcgtgtattagttattattcctcgcctaccagaggcctat
tttgttttcctaggctgtttaaaagcgggtattgttcctatttcatgctcagaaatgttg
cgcgcaagtgatttagagtatcgtatggagcattcttctgctagtgctgtgatcgcctat
gaagcatttactagtgaagtagataaaatctcttcttctgtcaatactttaaaaaacaaa
atggtcattggcacagctacaggagattggtcttctttagatgaattggctagctcgcaa
ccaaatacatttactgctgttgctactaaacgcgatgacatggcgttcctttcttatact
tctggaacaacaggtaagcctaagggtgtcgttcattctcatggttggggctacgcgcat
attcgaacagcggctgcacagtggctttgtgtacgtgaaggagacttagtatgggctact
gctgctccaggttggcaaaaatggatttggagtcctttcctatccaccattatgttgggg
gctacagcctttgtttatcatggtgggtttgatgcaaaaacatatcttcgcctgttgcag
gatgaaaaaattaatgttctctgctgcactccaactgaatatcgtatcatggcgaagctt
gagaatttaaaagactataatctatcctctctgcgtagtgctgtctctgctggtgaacca
ttaaatcgaccagtcattgaaacatttaagaatcactttgatctaaaagtccgcgatggt
tatggtcaaacagaaaatacattactcattggtactctggaaaacacagagttacgtcct
ggttccatgggtgtcccaactccaggtaatattgtacgtattatcgacaatgaaggaaat
gaggcacctgttggcgaggttggagatattgccatacacaaatcatcgccagcgttgttt
aaagagtattatcgggagcctgaacgcacacaagcggcattccgtggtgaatggtacatt
actggtgatcaagcgaaatgtgatgaagatggttatttttggtttgaaggtcgaggcgac
gatataattatctcatctggttacactattggtccctttgaagtagaagatgccttaaac
aagcatgatgctgtacaagagtgcgcagttgtggctgctccagatgaaattagagggcat
attgtcaaagcctatgtaatcttacgagatggctataaggaacacaatgaagaagaatta
attaaggagctacaggagcatgtaaaagcactgactgcgccttataaatatcctcgtagt
attgtctttatcgatgagttaccaaaaacaacatctgggaaaattcgtcgtatcgaacta
cgagcagcaactgtctaa

DBGET integrated database retrieval system