KEGG   Lysinibacillus sphaericus: Bsph_4572Help
Entry
Bsph_4572         CDS       T00656                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_4572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_4572
   00620 Pyruvate metabolism
    Bsph_4572
   00640 Propanoate metabolism
    Bsph_4572
  Energy metabolism
   00680 Methane metabolism
    Bsph_4572
Enzymes [BR:lsp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bsph_4572
Lipid biosynthesis proteins [BR:lsp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bsph_4572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4426361..4427938
Genome map
AA seq 525 aa AA seqDB search
MVIKDLIAPDVYNITEELEKFSQDSERQAIRWLNTQQERQTVTYVELVQKMNQYANAFTK
KGLQKGDRVLVIIPRLPEAYFVFLGCLKAGIVPISCSEMLRASDLEYRMEHSSASAVIAY
EAFTSEVDKISSSVNTLKNKMVIGTATGDWSSLDELASSQPNTFTAVATKRDDMAFLSYT
SGTTGKPKGVVHSHGWGYAHIRTAAAQWLCVREGDLVWATAAPGWQKWIWSPFLSTIMLG
ATAFVYHGGFDAKTYLRLLQDEKINVLCCTPTEYRIMAKLENLKDYNLSSLRSAVSAGEP
LNRPVIETFKNHFDLKVRDGYGQTENTLLIGTLENTELRPGSMGVPTPGNIVRIIDNEGN
EAPVGEVGDIAIHKSSPALFKEYYREPERTQAAFRGEWYITGDQAKCDEDGYFWFEGRGD
DIIISSGYTIGPFEVEDALNKHDAVQECAVVAAPDEIRGHIVKAYVILRDGYKEHNEEEL
IKELQEHVKALTAPYKYPRSIVFIDELPKTTSGKIRRIELRAATV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtaataaaggatttaattgcaccggatgtttataacattacagaggaattagaaaaa
ttttcgcaagatagtgaacgccaagctatacgttggttaaatacacaacaagagaggcaa
acagttacttacgtagagcttgttcaaaaaatgaatcaatacgctaatgcctttacgaag
aaggggcttcaaaaaggagatcgtgtattagttattattcctcgcctaccagaggcctat
tttgttttcctaggctgtttaaaagcgggtattgttcctatttcatgctcagaaatgttg
cgcgcaagtgatttagagtatcgtatggagcattcttctgctagtgctgtgatcgcctat
gaagcatttactagtgaagtagataaaatctcttcttctgtcaatactttaaaaaacaaa
atggtcattggcacagctacaggagattggtcttctttagatgaattggctagctcgcaa
ccaaatacatttactgctgttgctactaaacgcgatgacatggcgttcctttcttatact
tctggaacaacaggtaagcctaagggtgtcgttcattctcatggttggggctacgcgcat
attcgaacagcggctgcacagtggctttgtgtacgtgaaggagacttagtatgggctact
gctgctccaggttggcaaaaatggatttggagtcctttcctatccaccattatgttgggg
gctacagcctttgtttatcatggtgggtttgatgcaaaaacatatcttcgcctgttgcag
gatgaaaaaattaatgttctctgctgcactccaactgaatatcgtatcatggcgaagctt
gagaatttaaaagactataatctatcctctctgcgtagtgctgtctctgctggtgaacca
ttaaatcgaccagtcattgaaacatttaagaatcactttgatctaaaagtccgcgatggt
tatggtcaaacagaaaatacattactcattggtactctggaaaacacagagttacgtcct
ggttccatgggtgtcccaactccaggtaatattgtacgtattatcgacaatgaaggaaat
gaggcacctgttggcgaggttggagatattgccatacacaaatcatcgccagcgttgttt
aaagagtattatcgggagcctgaacgcacacaagcggcattccgtggtgaatggtacatt
actggtgatcaagcgaaatgtgatgaagatggttatttttggtttgaaggtcgaggcgac
gatataattatctcatctggttacactattggtccctttgaagtagaagatgccttaaac
aagcatgatgctgtacaagagtgcgcagttgtggctgctccagatgaaattagagggcat
attgtcaaagcctatgtaatcttacgagatggctataaggaacacaatgaagaagaatta
attaaggagctacaggagcatgtaaaagcactgactgcgccttataaatatcctcgtagt
attgtctttatcgatgagttaccaaaaacaacatctgggaaaattcgtcgtatcgaacta
cgagcagcaactgtctaa

DBGET integrated database retrieval system