KEGG   Lysinibacillus sphaericus: Bsph_4624Help
Entry
Bsph_4624         CDS       T00656                                 

Definition
elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
lsp  Lysinibacillus sphaericus
Brite
Mitochondrial biogenesis [BR:lsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bsph_4624
Exosome [BR:lsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bsph_4624
  Exosomal proteins of breast cancer cells
   Bsph_4624
  Exosomal proteins of colorectal cancer cells
   Bsph_4624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4464909..4466096)
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLSKKMGGTAKSYADIDNAPEEKERG
ITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEIRDLLSEYDFPGDDIPVIKGSALKALE
GEPEWEEKIVELMDAVDSYIPTPERQTDKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
DVVEIIGIAEEAKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREEIQRGQVLAKPGSI
TPHTNFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGICNLPEGVEMVMPGDNIEM
TVELIAPIALEEGTKFSIREGGRTVGAGVVASIQK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgaccgttctaaaacgcatgctaacattggtacaatcggacac
gttgaccatggtaaaactactttaactgctgctatcgctacagttctttctaaaaaaatg
ggtggtacagctaaatcatacgctgacatcgataacgctcctgaagaaaaagagcgtggt
atcacaatcaatacttctcacgtagaatatgaaacagaaactcgtcactatgcacacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcacaaatggac
ggcggtatcttagtagtatctgctgctgatggcccaatgccacaaactcgtgaacacatc
cttttatctcgtcaagtaggtgttccatacttagtagtattcatgaacaaatgtgatatg
gttgatgacgaagaattattagaattagtagaaatggaaatccgtgacctactatctgaa
tatgacttcccaggtgacgatattcctgtaatcaaaggttctgctcttaaagctcttgaa
ggtgaaccagaatgggaagaaaaaatcgttgaattaatggacgctgtagattcttacatt
ccaactccagaacgtcaaactgacaaaccattcatgatgccagtagaggacgtattctct
atcactggtcgtggtacagttgcaactggccgtgttgaacgtggtcaagttaaagttggt
gacgtagttgaaatcatcggtatcgctgaagaagctaaatctactactgtaactggtgta
gaaatgttccgtaaattattagactatgctgaagctggtgacaacatcggtgcattactt
cgtggtgtagctcgtgaagaaatccaacgtggtcaagtattagctaaaccaggttcaatt
actccacacactaacttcaaagctgaagtttatgttttatcaaaagaagagggtggccgt
catactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgtaaca
ggtatctgtaacttaccagaaggcgttgaaatggtaatgcctggtgataacatcgaaatg
acagttgaacttatcgctccaatcgctcttgaagaaggtactaaattctctatccgtgag
ggtggccgtactgtaggcgctggcgtagttgcttctatccaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system