KEGG   Lachancea thermotolerans: KLTH0A00726gHelp
Entry
KLTH0A00726g      CDS       T01117                                 

Definition
KLTH0A00726p
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
lth  Lachancea thermotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLTH0A00726g
Enzymes [BR:lth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KLTH0A00726g
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     KLTH0A00726g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(72979..77517)
Genome map
AA seq 1512 aa AA seqDB search
MERQLLLRVSGKGEPVVSCSYGQGVLTLPSLPVYDGYDESSPLFTVKLVIPGGSPVARDG
LVWTNCPVDAKTPFVRDKFNKKEIKATFHQDHHVELPVFRPGPFCFYFSFRNDRDELETT
RRFYFVVPPSLYIDDRYIPLNSLTMQSVVSKWMGSDWDKIFGKIASKGYNLIHFTPLQKR
GDSNSPYSIYDQLEFDPAFFPNNIDDVSKMVLKLHKEHGILAMTDVVLNHTANNSPWLRE
HPDSGYNHKTAPHLISAMELDKQLLEFSGKLRQLGYPTELNSTHDLFKIMDGIKIHVLGS
LKLWEYYVIDANQALDMVKNDWRQASHDQVEIPDSAKNDLVELANFIRDSASCENFGHLG
ERFSNRLEGSKFVAILKTLYGFELNDAVLEEAQKIVDEINLPLYREYDEDIGDILEQLFN
RIKYLRVDDHGPKLGPVTDKSPLTEPYFTRFNGSDGEEYALANNGWIWNGNPLVDFASSQ
SKAYLRREVIVWGDCVKLRYGAKPEDSPFLWKKMSEYIETCAKLFDGFRIDNCHSTPLHV
GEYYLDLARRHKPNLYVAAELFSGSEAMDCLFVERLGTSSLIREAMQAWSEEELSRLVHR
HGGRPIGSYKFMPLDDFAYPTNRQVEEFHIHNAKRVSEVNIPKNLTATPPHALFMDCTHD
NETPFQKRTLEDTLPNAALVSFCSSAIGSVYGYDECFPYLLDVVGEARTYDVTANDGISV
ARAQLHKIRDEIAQGSADIEDSEMHVHHEGQYITFQRNNAKNGSGWFLVARTKFGEKGEQ
KLPKIKFTGSRCEFSFAYSLLKAGGVPEDKNIIKGIPSKLEELSGFKVDYNEDLGESTIE
ITDSFPQGSIAVFKTQQNGIDETLLKFLTTGALKASEQLNLYSLNGLLYRCDAEERDISA
GSSGVYDVPDFGRLTYCGLQGWVSVLRKIIFSNDLAHPMSNHLRSGHWALDYVVQRLENY
KEQPGISEMQAWLASRFDRVKKLPSFLVPTYFALVIGIAYQCCRFRAIQNMPENVGSSTR
FVQSLALTSVQMLSEMRSTSLIPEKNVPCMAAGLPHFSTDYMRCWGRDVFISLRGLLLTT
ARFDDAKQHILAFARTLKHGLIPNLLDAGRNPRYNARDATWLFIQSIQDYVKMAPDGESI
LREKIPRRFPLDDTYITVDDPRAFSYETSIEDIIFEILSRHAKGISYREANAGPQLDRVM
SDRGFDVKIHVDWSTGLIHGGSQYNCGTWMDKMGESEKAGSFGVPGTPRDGAAVEISGLL
KSALRFVLELHEKKLFKYTKVEKEDGSQVTFKEWNNLVQENFEAKYFVPSDPSKDSEYDI
DETLVNRRGIYKDLYKAGKPYEDYQLRPNFAIAMTVAPELFTPELALQALDNADRIIRGP
VGMRTLDPSDYNYRPNYNNGEDSADFATSKGRNYHQGPEWVWCYGYFMRAFYRFHLAADA
RCQSKGSSKPSSYLYQQLYNRFEGQRNFIYGSPWAGLTELTNKDGALCSDSSPTQAWSSA
TTLDFFYDLWEH
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcaattgctactaagggtctcaggaaagggggaacccgttgtgagttgctct
tatggccagggcgttctcacactgccctcgcttcccgtttacgatggttatgatgagagt
tcgccgctttttacggttaaacttgtcatccctggtggttctccagtggcccgtgatggg
cttgtatggaccaactgccctgtcgatgccaaaacgccatttgttcgcgacaaattcaac
aaaaaagagatcaaggccacattccaccaggatcaccacgtggagcttcccgtttttagg
cccggtcctttttgtttctacttttcctttcgtaatgatcgcgacgagcttgaaacaact
cgtcgattttactttgttgttcctcctagcttatacattgatgaccgttatattccctta
aactcactgacaatgcaaagcgttgtctcaaagtggatgggcagtgattgggacaagatt
tttggcaagattgcgtcgaaaggttataatttaatccattttacacctctgcaaaagcgt
ggcgactccaattcaccctattcgatatacgaccaactcgagttcgatcctgcttttttc
cccaacaacattgatgatgtctccaagatggttcttaagttgcacaaggaacatggaatt
cttgccatgactgacgttgtcctcaaccatactgcaaacaactctccatggcttagagag
cacccggactctggttacaaccacaaaactgcccctcacttgatttcggcaatggagctt
gacaagcaattgctcgaattcagcgggaaactgaggcagcttggctaccccacggaattg
aattcaacgcatgatcttttcaaaattatggatggaatcaaaattcatgtacttggctct
ttgaaattgtgggagtattatgtcattgatgccaatcaagctttagatatggtaaagaat
gattggagacaggcttctcacgaccaagttgaaattcccgacagtgccaaaaacgatttg
gttgagttggcgaattttattcgtgacagcgcttcttgtgaaaattttggtcatttaggt
gaacgcttctcgaacaggcttgaaggatctaagtttgttgctatcctgaaaaccctatat
ggtttcgagctaaatgatgccgtcttggaggaagcgcaaaagattgttgatgaaataaat
ttgcctctgtaccgagagtatgatgaagacattggtgacatccttgaacagcttttcaat
cggatcaaatacttgagggtggacgaccatggccccaaacttggccctgttaccgacaaa
tcgccgcttactgaaccttactttacccgttttaatggcagtgacggagaggagtacgcc
ttggccaataatggctggatttggaatggaaatccattagttgacttcgcatcctctcaa
tcaaaagcttacctgaggcgcgaagttattgtttggggggactgtgttaagcttaggtat
ggggccaaacccgaagactcaccgtttttgtggaaaaaaatgtctgagtacattgaaact
tgtgctaagctgtttgatgggttcagaatagacaattgccattcaacacctttacatgtg
ggcgagtattatctggatttagcaaggaggcacaaacccaacctatatgttgctgcagag
ctgttctccgggtccgaggccatggactgcttgtttgtggagagacttggaacatcttct
ttgataagagaggctatgcaggcgtggtctgaagaagaattgtcaaggcttgtccataga
cacggaggaagaccaattggctcatataagtttatgcctttggatgattttgcctacccc
acgaacaggcaagttgaagagttccatatccataacgccaagcgcgtatcggaggtcaat
attccaaagaatttaactgccacaccgcctcatgcactatttatggactgtacacacgat
aacgagacgccatttcaaaagaggactttagaagatacattaccaaatgctgcgttagtt
agtttctgctcatcggccatcggatctgtttatggatatgatgaatgctttccctaccta
ttggatgtggtaggcgaggcaagaacctacgacgtgactgccaatgacggcatctcagta
gctagagcgcagctgcacaaaattagagacgaaattgctcaaggtagcgctgacattgaa
gattctgaaatgcatgttcaccacgaaggtcaatatatcactttccagagaaataatgcc
aaaaacggaagcgggtggtttttggtagcgcggacaaagtttggtgagaaaggtgagcaa
aagctacccaaaatcaaattcaccggatctcgttgtgagttcagctttgcatattcttta
ctcaaagctggaggagttcctgaagacaaaaatataatcaaaggcattcctagcaagcta
gaagaattatcagggtttaaagtcgactataacgaagacttaggagagtctactatagaa
attactgacagctttccccagggatcaatagccgtattcaagacgcaacagaatggtatt
gatgaaacacttctgaagtttctcacaactggtgccttgaaggcatctgaacaattgaat
ctttactccctcaatgggttactgtaccggtgtgatgcagaggagcgcgatataagtgca
ggaagttccggggtttacgatgttcctgactttgggcgactgacgtattgcggcctccaa
ggctgggttagcgtgttacgcaagataatcttttcgaatgatctagctcaccccatgagc
aaccatttgagaagtggtcactgggcgcttgattatgtcgttcaaaggctagaaaactac
aaggagcagccaggaatatctgagatgcaagcgtggcttgcgtctcggtttgatcgggtc
aagaagctaccatcatttttggtaccaacttatttcgcattggttatcggaattgcgtat
cagtgctgcagattcagagctattcaaaatatgcctgagaacgttgggtcctcaacaaga
tttgttcagagcttagcattgacttcggttcagatgttgtccgagatgcgttcgacttct
ctcatccctgagaagaatgtaccatgtatggctgcaggactccctcatttttccactgac
tacatgaggtgctggggcagagatgtttttatatcacttcgaggtctacttctcacgaca
gctcgatttgacgacgctaagcaacatatcttagcatttgcaaggaccctgaagcatggc
ttaatccccaaccttttggatgcaggccggaaccctcgttacaatgcgcgcgatgccaca
tggcttttcatacaatccatccaagattacgtgaaaatggcgcccgatggagaatccatt
ttacgtgaaaagattccaaggcgtttcccgctcgatgatacttatatcaccgtggatgac
cctcgtgctttctcttatgaaaccagtattgaagacatcattttcgaaatcctttccaga
catgccaagggcatcagttaccgggaagctaatgctggccctcagctggacagagtcatg
agcgatcgagggtttgacgtcaagattcatgtggactggtcgacaggtttaattcatgga
ggttcccagtacaactgtggcacctggatggataaaatgggagaaagcgaaaaagcaggc
tcctttggagttcccggtactccaagggacggagctgccgttgaaattagcggccttctg
aagagcgccttgaggttcgtcttggaattgcacgagaaaaagctctttaaatacactaaa
gttgaaaaggaagacgggagccaggtcactttcaaggaatggaacaacttggttcaagag
aactttgaagcaaaatactttgtaccatcggatccttcaaaagattcggagtatgacatt
gatgaaactttagtcaacagaaggggcatatacaaggacctgtacaaggctggaaagcct
tatgaagactaccaattaaggccaaatttcgccattgctatgactgttgctccagagctg
ttcactcccgaacttgcgctccaggcgcttgataacgctgaccgcataattcgcggtcct
gtgggtatgcggactctcgatcccagtgattacaactatcgccccaactataacaatgga
gaggattcggccgattttgcgacctcgaaaggtaggaactatcaccaaggccctgaatgg
gtgtggtgctatggctactttatgcgcgccttttacaggtttcatctcgcggctgatgcg
cgctgccaaagcaaaggcagctccaagccatcctcctacctttaccagcagctgtataac
agattcgaaggccagcgcaattttatctatggcagtccctgggctggcttgacagaactc
actaacaaggacggcgcgctatgctccgattcgagccctacacaagcctggagctctgca
actactttggatttcttttacgatttatgggaacattga

DBGET integrated database retrieval system