KEGG   Lachancea thermotolerans: KLTH0A03982gHelp
Entry
KLTH0A03982g      CDS       T01117                                 

Definition
KLTH0A03982p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lth  Lachancea thermotolerans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KLTH0A03982g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     KLTH0A03982g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:334027..334890
Genome map
AA seq 287 aa AA seqDB search
MDSLPFDSKTLLIGGFVAFFVITLASRFLGSKKAIPVLIKDQYQEFPLVSKTVLTHNTAV
YRFGLPKQSDVLGLPIGQHISIKGNLPDGKEIMRSYTPTSLDSDSVGFFELLIKSYDQGN
VSKMIGELQIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGTGIAPMYQIIKAIHSDPKDRT
KVSIVYGSQTEDDILLKKELDAIVESNPEQFKVHYLLDKPARDTWTGGVGYVTPDVMKSY
LPAPGPGAQLLVCGPPGMVSSVKKNAVALGFEKAKPVSKMGDQVFVF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggattcgctgccattcgactcgaaaacactattaattggggggtttgtggccttcttc
gtcattacactcgcctcccggttcttgggatcaaagaaggcgattccagtgttgatcaag
gaccaataccaggaattccccttggtttcaaaaactgtcttgacccacaacacggcagtt
tacaggttcggcctgccaaagcaatctgatgtgctcggacttccaatcggccagcacatc
tcgatcaagggaaacttgccagacggcaaggagatcatgagatcttacactcccacctcc
ttggactcagactccgttggtttcttcgaattgttgatcaagtcttatgatcaaggtaac
gtctctaagatgatcggagagctccaaatcggcgacaagatcaaagtgcgcggccctaaa
ggattctacacatacacccctaatatgaattccgagatcggcatgatcgccggtggcact
ggtattgctcccatgtatcaaatcatcaaggctatacactctgacccaaaagaccgtaca
aaagtgtctatcgtttacggtagtcagactgaagatgacattctattgaagaaagagctg
gacgcaattgtcgagtctaacccagaacagttcaaggtccactaccttctggacaagcct
gctagggacacttggactggcggcgttggatacgttactcctgacgtcatgaaaagctac
cttccagcacccggtccaggcgcccaattgcttgtctgcggccctccaggcatggtttcc
tctgtgaagaagaatgctgttgctctaggcttcgagaaggctaaacctgtctccaaaatg
ggtgatcaagtcttcgtcttctga

DBGET integrated database retrieval system