KEGG   Lachancea thermotolerans: KLTH0A04312gHelp
Entry
KLTH0A04312g      CDS       T01117                                 

Definition
KLTH0A04312p
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     KLTH0A04312g
    1.3.1.94  polyprenol reductase
     KLTH0A04312g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:362792..363535
Genome map
AA seq 247 aa AA seqDB search
MDLNPRSLFELAFYSSFLLAITSVLLAKWRLPTLLKYGKTLQGVPSKGGILGSLQSLTVP
KKWFGHFYVYSTALALLNVCFLRGFASLLVLTHSARRLYETRCVSKFGKDSRIHLSHYLV
GLWFYTAVNCAVFVDRTRTRSPLARLVAVIVFVLSSLDQYRNHLHLSKLVKYTLPTYGLF
QLVSSPHYFDEILIYLSLAIYTSSLKMFLCLVWVIVNLSTSALETRSWYAKKFPRAAPSF
AIIPYLL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaacccccgctcgttgttcgagctcgcgttctattccagcttcctgctagcc
attacatctgtactcttggctaaatggcgcctgccaaccctcctcaagtatggcaaaaca
ctgcagggcgtgccctccaagggcgggatcctgggctcgctgcagagtctcaccgtaccc
aaaaagtggttcgggcacttttacgtgtactctaccgctctggcactgctcaacgtgtgc
ttcttgagaggcttcgcgtctctacttgtgctcacacattcggccaggaggctttacgag
acgcgctgcgtcagcaaatttggcaaagactccagaattcatctgtcgcactacctagtg
gggctctggttttacacggcggttaattgcgctgtcttcgtggacagaacgcgcactcgc
tccccgttggcgcgcctcgttgctgtcatcgtgtttgtgctctcgtcgctcgaccagtac
cgaaaccacctgcacttatcaaaactcgtcaagtacacgcttccgacatatggccttttt
cagctcgtctcaagcccgcactacttcgacgagatcctcatctacttatcgctcgcaatc
tacacgtcctccctcaagatgtttctttgcctagtgtgggtgatcgtcaatctctctact
tccgccttggaaaccaggagctggtatgctaagaaattcccgcgtgccgctccatctttc
gcaattattccgtatcttctataa

DBGET integrated database retrieval system