KEGG   Lachancea thermotolerans: KLTH0A05874gHelp
Entry
KLTH0A05874g      CDS       T01117                                 

Definition
KLTH0A05874p
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lth  Lachancea thermotolerans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLTH0A05874g
   01230 Biosynthesis of amino acids
    KLTH0A05874g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0A05874g
   00030 Pentose phosphate pathway
    KLTH0A05874g
   00051 Fructose and mannose metabolism
    KLTH0A05874g
   00052 Galactose metabolism
    KLTH0A05874g
  Energy metabolism
   00680 Methane metabolism
    KLTH0A05874g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KLTH0A05874g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KLTH0A05874g
Protein phosphatases and associated proteins [BR:lth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KLTH0A05874g
Messenger RNA biogenesis [BR:lth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KLTH0A05874g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(482307..485327)
Genome map
AA seq 1006 aa AA seqDB search
MRNSVSITSSFYDFIKDKLREVRPKRANLAQRRSKSNFSTSESIFLSIEMTVDIPLVNGT
SECTVTAYSKDTYQSAVDFYAQFLQLEQESAAGTSTFLRNSNVALEVVLVEDSKKHAASE
ERLQKLTSSLETADWRSLVSDSLVFKAVDVAQCKANLEEQKASYQAYPTDLFPMELYAVD
PVGNVVGVTKTKNAVSAMPTAPPASKGSFTSTAPSSAQSTIDLTSAGSMSISDSLTAEPK
GSEQKAIAVMTSGGDAPGMNANVRAIVRTAISKGCRAYVVMEGYEGLVRGGPEYIKQFNW
EDVRGWSSEGGTNIGTARCMEFRERAGRLLGALHLIEAGVDALIVCGGDGSLTGADLFRS
EWPSLLEELRDTGKITSEQYTRYKHLNICGTVGSIDNDMSTTDATIGAYSSLDRICRAID
YIEATANSHSRAFVVEVMGRNCGWLALMAGIATTADYILIPEKPASSREWQDQMCDIVSK
HRSRGKRTTIVVVAEGAIANDLTPISPNDVHKVLVDRLGLDTRVTTLGHVQRGGTAVAYD
RILATLQGVEAVNAVLESSPDTPSPLIAINENKITRKSLVDSVRLTKSVAEAIHAKDFKK
AMSLRDTEFVEHLNNFMAVNSADHNPPKLPQEKRLKIAIVNVGAPAGGINSAVYSMATYC
MSQGHRPYAIYNGWSGLARHESVRSLDWKSMLGWQSRGGSEIGTNRVTPEEADIGMIAYY
FQKYQFDGLMIVGGFEAFVSLHQLERARENYPAFRIPMVLIPATLSNNVPGTEYSLGTDT
ALNALMDYCDVIKQSAASTRGTAFVVDVQGGNSGFLATNASLAVGAQVSYVPEEGISLEQ
LSEDIETLRESFETAQGRNRFGKLILKSKNASKVFTPEVLAEVMTSEAKGSFSAKSAIPG
HVQQGGLPSPIDRTRATRLAIKAVGYIEQQQEVIAKARADDEEFDPDNKEISATAAVLGI
KGSHVVFSSIRQIYDFETEVVKRMPKVIHWESTRAIADSLVGRKKV
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacagcgtgtctatcacctcatccttttacgattttataaaagacaagttgaga
gaagtcagaccaaagagagcgaatttagcgcaaagaagatccaaatcgaatttctcgacc
tccgaaagcatctttctcagcatcgagatgactgttgatattccattggtcaacggtacc
tcagaatgtaccgtgaccgcatattccaaagacacctatcagtcggctgtggacttttac
gcgcagttcctgcagctggagcaggagagcgcggctggcacatcgacctttctccgtaac
tcgaacgtcgcgctggaagttgttctggttgaagactccaagaagcacgccgcgagcgag
gagcgtctccaaaagctcaccagcagcctcgagacggctgactggagatcccttgtgtct
gactccctagtcttcaaggctgtcgacgtggctcagtgcaaggctaacctagaagagcag
aaggccagctaccaggcctacccaaccgacctgttccctatggagctctacgctgtcgac
ccagtcggcaacgttgtcggtgtcactaagaccaagaatgctgtcagcgctatgcctact
gccccccctgcttctaaggggagcttcacctccacagccccatcttccgcacagtcgacc
attgacttgacaagcgcaggttccatgtcgatctcggactctttgactgccgagccaaag
ggctctgagcagaaggccattgctgtcatgacctccggtggtgacgctcctggtatgaac
gccaacgttcgtgccattgtgcgtactgctatttctaagggctgccgtgcctacgttgtg
atggagggttacgaaggtttggtgcgtggtggccctgagtacatcaagcaattcaactgg
gaagacgtccgtggctggtctagcgagggtggtaccaacatcggtactgctcgttgcatg
gaattcagagagcgtgcggggagacttcttggtgctttgcacttgatcgaggccggtgtc
gacgcattgatcgtatgtggcggtgacggttcgctaaccggtgctgacctcttcagatcc
gagtggccatctctgctcgaggaactgagggacacaggcaagatcacatctgaacagtac
actagatacaagcacctgaacatttgtggtactgtcgggtccattgacaacgatatgtct
accaccgatgccacaattggtgcttactcttctctggacagaatctgcagagccattgac
tacattgaggcaaccgctaactctcactccagagccttcgttgtcgaggtcatgggtaga
aactgtggttggttggctttgatggccggtattgccactaccgctgactacattctgatc
ccagaaaagcctgcttcttccagggaatggcaagaccagatgtgcgacattgtctcgaag
cacagatcaagaggcaagagaactaccattgttgttgttgctgaaggtgccattgccaac
gacctgactccaatttctcctaacgacgtccacaaggtccttgttgacagattgggtcta
gacactagagttactacgctaggtcacgtccagagaggtggtactgctgttgcttacgac
cgtattctggccactctacagggtgttgaggctgtcaatgccgttttggaatccagccca
gacactccatctcctctcattgccatcaacgagaacaaaatcactcgtaagtcattggtt
gactctgtcagattgaccaagtctgttgcagaggctattcacgccaaggacttcaagaaa
gccatgagcttgagagacactgagtttgttgagcacttgaacaacttcatggctgtcaac
tctgccgaccacaaccctcctaaattgccacaagagaagagacttaagattgccattgtt
aacgtcggtgctcccgctggtggtatcaactccgctgtctactccatggctacctactgt
atgtctcaaggtcacagaccttacgctatctacaacggttggtccggtttggccagacat
gagagtgtccgttccctagactggaagtccatgcttggctggcagagccgtggtggttcc
gaaatcggtaccaacagagttacccctgaggaggctgacatcggtatgattgcctactac
ttccagaagtaccagttcgatggtttgatgatcgttggtggtttcgaggcctttgtctct
ttgcaccagttggaaagagcaagagaaaactaccctgctttcagaattccaatggtgttg
atcccagccactctgtccaacaacgttccaggtactgagtattccttgggtactgacacc
gcccttaacgctttgatggactactgtgacgttatcaagcagtctgctgcctccaccaga
ggtactgcattcgttgttgacgtccagggtggcaactcaggtttcttggcgacaaatgct
tctctagctgttggcgcccaggtttcctacgttccagaggagggaatttctttggagcag
ctgtcagaggacattgaaactctacgcgaaagcttcgagaccgctcaaggcagaaacaga
ttcggtaagttgatcctcaagtcgaagaacgcctctaaggtgtttaccccagaggtcttg
gctgaggtcatgacttctgaggctaagggttcattcagcgccaaatctgcaatcccaggt
cacgttcaacagggtggtttgccatctccaattgacagaaccagagccacaagactggct
atcaaggctgttggttacattgagcagcaacaagaggtcatcgcgaaggctcgcgctgac
gatgaggagtttgacccagacaacaaggagatttctgccactgctgccgtgctaggtatc
aagggttcccacgttgtgttctcctctatcagacaaatctacgactttgagactgaggtc
gtcaagaggatgccaaaggtcatccactgggaaagcaccagagctattgctgacagcttg
gtgggtagaaagaaggtgtaa

DBGET integrated database retrieval system