KEGG   Lachancea thermotolerans: KLTH0A06050gHelp
Entry
KLTH0A06050g      CDS       T01117                                 

Definition
KLTH0A06050p
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
lth  Lachancea thermotolerans
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KLTH0A06050g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KLTH0A06050g
   00640 Propanoate metabolism
    KLTH0A06050g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    KLTH0A06050g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    KLTH0A06050g
Enzymes [BR:lth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     KLTH0A06050g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     KLTH0A06050g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(504244..510936)
Genome map
AA seq 2230 aa AA seqDB search
MSEESLSEVGVSQKDQYEVTDYTSKHASLAPHFLGLNTVEKAEDSPLKEFVKCHGGHTVI
SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEV
PGGTNNNNYANVDLIVEIAERADVDAVWAGWGHASENPLLPERLAKSPRKVIFIGPPGNA
MRSLGDKISSTIVAQHASVPCIPWSGTGVDQVHLDKENGLVSVTDDVYQKGCCDSPEDGL
AKAKQIGFPVMVKASEGGGGKGIRKVEREEDFIPLYKQAANEIPGSPIFIMKLAGKARHL
EVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFSEMERSAVRLGKLVGYV
SAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRVKDIR
LLYGVDPHTATEIDFDFSSKDSKQIQRKPTPKGHCTACRITSEDPNEGFKPSGGSLHELN
FRSSSNVWGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTT
VEYLIKLLETEDFEGNSITTGWLDDLISQKMTAEKPDPTLAVICGAATKVFIASENGRKE
FITSLQKGQVPNKSLLQTMYPVEFIHDGKRYKFTVAKSADDRYTLFINGSKCEVGVRKLS
DGGLLIAVGGRSHTIYWKEEVSATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENG
DHVNAGQPYAEVEVMKMQMPLVSQESGIVQLLKQPGSTVSAGDILAILALDDPTKVKHAM
PFEGMLPDMGAPIVEGTKPAYKFRSLVSTLENILNGYDNQVIMNASLQQLIEVLRNPQLP
YSEWKMQSSALHSRLPIKLDEQLEQLVNRSLSRNAHFPARQLGKMLEAAQKESDDPLFGT
VIEPLLDISTRYADGLEAHEHSVFAKFLQNYYQVEKLFSGTNVREEDVILKLRDENAENL
DRVALTVLSHSRVSAKNNLILAILKHYQPLCKMSSEVSSRISEPLKQIVELESKATAKVA
LQAREILIQAALPSVRERTDQIEHILRSSVVQTAYGAFDNKRTDPDLEILKDLIDSNYVV
FDVLTQFLTHRDPSVAAAAAEVYIRRAYRAYTIGDLKHYNHANNAVVEWKFQLPSAAFAS
VPQMKSKLGMHRAISVSDLTYVSEGDNQPLRTGILIASTHLDDVDEGLSKGLQLVPHHTS
SSGPVPDRSGSNATLSNVANVSVSSTDGFESEEEVLRRLREILDMNKQQLVEASIRRITF
IFGYEDGTYPKYFTFRGPSYAEDETIRHIEPALAFQLELGRMSNFNIKQLFTENRNIHVY
EATGKNSAVDKRFFTRGIIRTGRISDDITIQEYLTSEANRLMSNILDNLEVIDTSNSDLN
HIFIHFSAVFDVSPEDVEAAFGGFLERFGKRLLRLRVAAAEIRIIIKDPQTGAPVPLRAL
INNVSGYVVKTELYTEVKNAQGEWVFKSLDKPGSMHLRPIATPYPAKESLQPKRYKAHLM
GTTYVYDFPELFRQATVSQWKKISPKTKLSDEFFIANELIEEEDGELTEIDREAGANTIG
MVAFKVTVKTPEYPRGRQFVIVANDITFKIGSFGPQEDAFFNKVTEYARKRGIPRIYLSA
NSGARIGVAEELIPLFNVSWNDPENPAKGFQYLYLSSEGMAELKKQAKDASVVTERVVED
GEERFVIKSIIGADDGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLG
QRAIQIEGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTAEDDLAGVQKI
MEWLSYVPARRDLPVPILETEDKWDREVDFTPSTSEPYDVRWMIEGRNTPEGFEYGLFDK
GSFQETLSGWAKGVVVGRARLGGIPLGVIGVETRMVENMIPADPANPVSTESLIQEAGQV
WYPNSAFKTAQAINDFNYGEQLPLMIMANWRGFSGGQRDMYNEVLKYGSFIVDALVGYKQ
PIFTYIPPTGELRGGSWVVVDPTINAEQMEMYADVNSRAGVLEPEGMVGIKYRREKLLAT
MARLDETYKNLKTQMSDPGLSVEKHQEIATKLAAREKMLMPIYHQITVQFADLHDRSGRM
VAKGVISKELDWPEARRFFFWRLRRRLNEEYLMKRLNTELPNAPRLEKIARLSSWYPASV
DREDDRIVANWIEENYSVLEEHLKALKVESFAQNLAKSIRSDHENAISGLSEVLKLLSAE
DKAKILNSLK
NT seq 6693 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagagagtctatccgaagtgggcgtctcccaaaaagatcaatacgaagttaca
gactatacctcgaaacatgccagcctagcccctcacttcttggggctgaataccgtggaa
aaggccgaagactcgcctctgaaagagttcgtcaagtgccacggcggccacaccgtcatc
tctaaagtgcttatcgccaacaatggtattgcagctgtcaaagagatcagatctgtacgc
aagtgggcctacgagactttcggcaacgagcgtgccgtccaattcgtggccatggccact
cccgaggacttggaagccaacgccgaatacctgcgtatggctgaccagtacgtcgaagtc
cccggtggcaccaacaacaacaactatgctaacgtcgacctcattgtcgaaatcgccgag
agagccgacgtcgacgccgtctgggctgggtggggtcacgcatccgagaacccccttctt
cccgagaggctagccaaatctccacgtaaagtcattttcatcggccctccaggcaacgcc
atgagatccctgggtgacaaaatctcctctactatcgtcgcccaacatgcctccgttcca
tgtatcccatggtccggtactggtgtcgatcaagtccacttagataaagagaacggtctg
gtatctgtcaccgatgatgtctaccaaaaaggttgctgcgactcccccgaggacggtctg
gctaaagccaagcagatcggctttccagtcatggtaaaggcctccgaaggtggtggtggt
aagggtatcagaaaggtcgagagagaagaagactttattccactctacaagcaggctgcc
aatgagattccgggctctccaattttcatcatgaagttggctggtaaggctcgccacttg
gaagtacaactgctggccgatcagtatggtacaaacatctcgctgtttggtcgtgactgt
tccgttcagagacgtcaccaaaaaatcatagaagaagcgcccgtcactatcgcgaagcct
gacacgttctctgaaatggagagatcggctgtcagactgggtaaattggttggttacgtt
tccgctggtactgtggaatatttatactctcatgatgatgacaagttttacttcttggag
ctgaaccctagactacaggttgagcatcctactactgagatggtgaccggggttaacctg
cccgcggcccagcttcaaattgcgatgggtatcccaatgcacagagttaaagacattaga
ctactttatggggtggaccctcacactgctactgaaattgactttgatttcagttctaaa
gattccaagcaaatccagagaaagccaactccaaagggccactgtaccgcctgtcgtatt
acttcagaggaccctaatgagggtttcaaaccctcaggtggttcgttgcacgagctaaac
ttccggtcttcttctaatgtctggggttatttctccgtgtcaagcagtggtggtatccac
tccttctcggactctcaattcggacacatcttcgcatttggagagaacagacaggcatcc
cgtaagcatatggttgttgccctgaaagagctatctatcagaggtgatttcagaactact
gttgaatacctcatcaagcttttggaaaccgaagactttgagggcaactccattacaacc
gggtggttggatgacttgatctctcaaaagatgaccgccgagaaaccagatcccactttg
gcagtcatttgcggtgctgccactaaggtttttatcgcttctgaaaatggccgtaaagag
ttcattaccagcttgcaaaagggtcaagttcctaacaagtctctcctgcaaacaatgtac
cctgtcgaattcattcatgatggaaagcgctacaagttcactgtggcaaaatccgctgac
gaccgttacactttgttcatcaacggttctaagtgtgaggttggtgtccgcaagctttct
gatggcggtttgttgatcgccgttggcggtagatcccacaccatctactggaaggaggaa
gtctcagccaccagactatctgtcgactctatgacgacccttctagaagttgaaaacgat
cctacccagctccgtaccccttctccaggtaagctcgttaagttcttggttgaaaacggc
gatcacgtcaatgctggccagccatatgctgaggttgaagttatgaagatgcaaatgcct
cttgtttcccaagaaagcggtatcgttcagctgttgaaacaaccaggttccactgtgtca
gctggtgacatcttggccatcttggccttagacgatcctaccaaggtcaagcacgccatg
ccattcgagggtatgctgccagacatgggtgccccaatcgttgaaggtactaagccagca
tacaagtttagatccttggtttcaactcttgagaatatcctgaatggttatgacaatcaa
gttatcatgaatgcttccctgcaacagctgattgaggttttgagaaaccctcaactgcct
tactcggaatggaaaatgcaatcttctgctttgcactcaaggttgcctatcaagcttgac
gaacagcttgaacagttggtcaaccgctctttgagcagaaacgcgcacttccctgccaga
caactcggcaagatgcttgaagctgcgcaaaaagagtcagatgatccactatttggtact
gtgattgaacctttgctcgacataagcactcgttatgccgatggtctggaggctcatgaa
cattctgtattcgccaagttcttgcagaactattaccaagtcgagaagctcttcagtggc
accaacgttcgtgaagaagatgttatcttgaaactgcgtgacgaaaacgctgaaaatctg
gaccgcgttgccctgactgtcttgtctcactctcgcgtttcagccaagaacaacttgatt
ttggctattctgaagcattaccagccactctgcaaaatgtcttctgaggtctcttctcgc
atctcggaacctttgaagcaaattgtcgagttagagtccaaggctactgccaaggttgca
ttacaggccagagaaatcttgattcaggctgccttgccatctgtgagagaaagaactgac
cagatcgagcatattttgagaagctctgttgtccaaaccgcatacggcgcctttgacaac
aagcgcactgaccctgacttggaaatcttaaaggatttgatcgattccaactacgtcgtg
ttcgatgtcctgacccagttcctcacacatcgcgatccttctgttgctgccgcagctgct
gaagtttacattcgtcgtgcttacagagcttacacgattggagacctgaagcactacaat
catgcaaacaacgctgttgtggagtggaagttccagcttccttctgctgcttttgcctcc
gttcctcagatgaagagcaaacttggtatgcacagagccatctcggtgtctgatcttacc
tacgtctctgagggtgacaaccaacccctaagaactggtattttgattgcgtctacccat
ttggacgatgttgacgaggggctttcaaagggtctacagcttgtcccccatcacacttcc
tccagcggacccgttccggacagatctggtagcaacgctaccctaagtaacgttgccaac
gtctcggtttcttcgactgacggtttcgaatcggaagaagaagtcttgaggagattgaga
gagattttggacatgaacaagcaacagcttgtggaggcctctattcgtcgtatcactttc
atttttggttacgaagacggaacatatccaaagtacttcactttcagaggaccaagctac
gccgaagatgaaaccattcgtcacattgagccagcacttgccttccaacttgaactcgga
agaatgtcgaatttcaacatcaagcaactgttcactgaaaacagaaacattcatgtgtat
gaagccaccggtaagaactctgctgtggacaagaggtttttcacaaggggtatcatcaga
accggccgtatcagcgatgatattactatccaggaatacctgacctctgaggccaaccgc
ctgatgagtaacattcttgacaacctggaggttattgatacttctaactcagatttgaac
cacatcttcatccacttctctgctgtcttcgatgtttctccagaggacgtcgaagctgcc
tttggcggattcttggagagattcggtaaaagactactcagactgcgtgttgctgccgct
gaaattcgtattatcatcaaggaccctcaaactggcgccccagttcctttgagagctttg
atcaacaacgtttcaggttacgtggtgaagaccgagctttacaccgaggtcaagaacgcc
caaggtgaatgggtcttcaagtctctagacaagccaggctccatgcacttgagacctatt
gctaccccataccctgcgaaggagtctttgcaaccaaagcgttacaaggctcatttgatg
ggtaccacgtacgtttacgatttcccagagcttttccgtcaagcaactgtttctcagtgg
aaaaagatttcgccaaagacaaaactttccgacgagttcttcattgccaatgaactgatt
gaagaagaggatggtgaactcacggaaattgaccgtgaggctggtgctaacactattggt
atggttgctttcaaggtcactgtcaagacgcctgaataccctcgcggccgtcaatttgtt
attgttgccaacgatatcacctttaagatcggatctttcggtcctcaggaagatgcattc
ttcaacaaagttaccgaatacgccagaaagcgtggtattccaagaatctacctatcggct
aactccggtgccagaattggtgttgctgaggaactgattcctctgtttaacgtttcatgg
aacgaccctgagaacccagccaagggcttccaatacctatacttgtcttctgaaggcatg
gctgagctgaagaagcaagccaaggacgcttctgttgtcacagagcgtgtggtcgaagat
ggtgaggaacgcttcgttatcaagtccattattggtgctgatgatggtctaggtgttgag
tgtttgaagggttccggtttgatcgctggtgcaacttccagggcttacaaagacatcttc
acgattactctcgttacatgcagatctgtcggtattggtgcttacctggtgagattggga
caaagagccattcaaattgagggtcagcctatcattttgactggtgcccctgctatcaac
aagcttctcggtcgcgaagtttactcttctaacttgcagcttggtggtactcaaatcatg
tacaacaatggtgtttctcacttgactgcagaggatgaccttgctggtgtccaaaagatc
atggaatggttgtcttacgttccagcaagacgtgacttgcctgttcctatcctcgagaca
gaagacaaatgggacagagaagtggacttcacaccatcgactagtgagccatatgacgtt
agatggatgatcgagggtcgcaacactcccgagggcttcgaatacggtctgtttgacaag
ggctctttccaagaaactctatctggctgggctaagggagttgtcgtcggaagagctcgt
ttgggaggtattcctcttggtgttatcggcgttgaaacaagaatggtagaaaacatgatt
ccagccgacccagctaaccccgtctctaccgaatctttgattcaagaggctggtcaggtt
tggtatccaaactctgctttcaagactgctcaagccattaacgacttcaattatggtgag
cagctgccattgatgatcatggctaactggagaggtttctcgggtggtcaacgtgacatg
tacaatgaagttttgaagtacggatctttcattgttgacgcattagttggatacaagcaa
cctattttcacctacattccacccaccggcgaactgagaggtggctcttgggttgttgtt
gatcctacgatcaatgccgaacaaatggaaatgtatgctgatgtcaactctagagctggt
gtcttagaaccagaaggaatggttggaatcaagtaccgtagagagaagctgcttgccact
atggcgagactggatgaaacttacaagaatctgaaaacccagatgtctgacccaggtctc
tctgtcgagaagcatcaagagatcgccacgaagcttgctgcccgtgaaaaaatgttgatg
cctatttaccaccagatcaccgttcagtttgctgacttgcatgacagatcgggccgtatg
gttgctaagggtgtcatcagcaaggaactagattggccagaggctcgtcgcttcttcttc
tggagactaaggagaagactcaacgaggagtacttgatgaagagattgaacacagagctt
ccaaacgctccaagacttgagaagattgccagactaagctcatggtaccctgcctcagtt
gacagagaggatgacagaattgtggccaattggattgaagagaactacagtgttctggaa
gaacatctaaaggcattgaaggttgagtcatttgctcaaaatctcgcaaagtccatcaga
agcgaccatgaaaacgcgatcagtggcttgagcgaggtcttgaaattgctgtctgccgaa
gacaaagcaaagattctcaacagtcttaaataa

DBGET integrated database retrieval system