KEGG   Lachancea thermotolerans: KLTH0A06336gHelp
Entry
KLTH0A06336g      CDS       T01117                                 

Definition
KLTH0A06336p
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lth  Lachancea thermotolerans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KLTH0A06336g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0A06336g
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KLTH0A06336g
Enzymes [BR:lth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KLTH0A06336g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:528991..530520
Genome map
AA seq 509 aa AA seqDB search
MSKTYRSTRSSSKDTKSFEETIIQGLASDGGLFIPSEIPQVSEETLKQWSQLSFQGLALE
IMKLYISSEEIPEADLKVLIERSYSTFRSKDVTPLAKDVTGKNEHLHILELFHGPTYAFK
DVALQFVGNLFEYFLQRANKDLPQEQRKRITVVGATSGDTGSAAIYGMRGKKDVSVFILY
PTGRISPIQEEQMTTVPDQNVQTLSVKGTFDNCQDIVKAIFGDVEFNKKHNVGAVNSINW
ARILAQMTYYFYAYFQATNGSPSKVKFVVPSGNFGDILAGYYAKKMGLPVERLIIATNEN
DILDRFLKSGVYERSDDVAATLSPAMDILISSNFERLLWYLARDVLASNDDQKAGEILNQ
WFTQLKTKGKFEVDSAVVKHALVDFDSERVSNAETTSTIKETYANSQNPQHYILDPHTAV
GVCATKRQMAKDNDKSIQYISLSTAHPAKFAEAVNEALSSFEGYSFEKDVLPDELKVLST
LEKKLKFVEKADVELVKSAIEEELAKMGL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaacttacagatccactagatcctcttccaaagacactaagtcatttgaggaa
actatcattcaaggcttagcctctgatggcgggcttttcattccttccgagatcccacaa
gttagcgaagaaaccctgaagcaatggtctcagctgagtttccagggcttggctttggaa
atcatgaaattgtacatttccagcgaagagatcccagaagctgatcttaaggtcttgatc
gagagatcatactcgacgttccgctctaaggatgtgacgccattggcaaaagacgtgact
ggcaagaacgagcatctgcacattttggagctgtttcacggcccaacctatgctttcaag
gatgttgcgttgcaattcgtgggtaacttgttcgaatacttcttgcaaagagcgaacaag
gacttacctcaggaacagagaaagagaattactgtggtgggtgctacttccggtgacact
ggtagtgctgccatctatggtatgagaggcaagaaggacgtttctgtattcatcctatac
ccaactggcagaatctcccctatacaagaagaacaaatgacaactgttcctgaccaaaat
gtgcaaactctttctgttaagggtacttttgacaactgccaagacattgtcaaggccatt
ttcggtgacgtcgaatttaacaagaagcacaacgtcggagccgtgaattctatcaactgg
gccagaatcttggctcaaatgacttactacttttacgcctacttccaggccacaaacggc
tctccaagtaaagtcaagtttgtcgtcccaagtggtaactttggtgacattcttgccggt
tactacgccaaaaagatgggcctccctgtggaaagactaatcattgccactaatgaaaac
gatattctcgacagattcttgaaatcaggtgtttatgaaagatctgacgatgttgcggct
accctgtcaccagccatggatatcttgatttcctcaaactttgagagactgctttggtac
ctagcccgtgacgtccttgcttcaaatgatgaccaaaaagcaggcgagattctgaatcag
tggttcactcagcttaaaaccaaaggaaagtttgaggttgactctgctgtcgttaaacac
gccctggttgacttcgattctgaaagagtctccaatgctgagacaacctcgactatcaaa
gagacctatgccaactctcaaaaccctcagcactatatcttggatcctcacactgctgtc
ggtgtgtgcgccacgaagagacagatggcaaaggacaacgacaaatcgatccaatatatt
tctttgtccactgcccacccagctaagtttgccgaagctgtgaatgaagctctatcttct
ttcgaaggctactctttcgagaaagacgttttgccagacgagctgaaggttctttcgaca
ctagaaaagaagttgaaatttgttgaaaaggctgatgtcgagcttgtgaagagcgccatt
gaggaggagttggctaaaatggggttataa

DBGET integrated database retrieval system