KEGG   Lachancea thermotolerans: KLTH0B00968gHelp
Entry
KLTH0B00968g      CDS       T01117                                 

Definition
KLTH0B00968p
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
lth  Lachancea thermotolerans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KLTH0B00968g
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KLTH0B00968g
Enzymes [BR:lth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KLTH0B00968g
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     KLTH0B00968g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(83522..84985)
Genome map
AA seq 487 aa AA seqDB search
MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLEEIDDLKPDCVFISPGP
GHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVSYAGEIVHGKTSQVTHDNK
GIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGIIMGVRHKNLTVEGVQFHPESI
LTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSILDKIYAQRQKDVDELSATPGFTL
RDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKRASPSKGDIDMNAIAAEQGLKYAKA
GASAISVLTEPHWFKGSIQDLVNVRRALDIEFKNAPQDRPCVLRKEFIFSKYQILEARLA
GADSVLLIVKMLSQDLLLELYNYSKFEVGIEPLVEVSSKEEMGRALELNAKVVGVNNRDL
HSFNVDLNTTSSLASSVPEGTILLALSGITSGADAEKYKKEGVKGLLVGEALMRAANVDS
LIKDLSA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtgttttcagcaaaaagaagagtagtcctaattgacaactatgactcgttcacctgg
aacctttatgagtacctatgccaggaaggagcagaggtgctagtctaccgtaacgaccaa
atcacgctagaggagattgatgatctaaagcccgactgtgtcttcatctcgccaggccca
ggccaccccagaactgactctggtatatccagagactgcgttcgtcacttcgcaggaaag
attcctgttgtcggtgtctgcatgggtttgcagtgtatgtttgacgtctttggtggaaca
gtatcctacgctggcgagatcgtgcacggaaagacatcgcaggtgactcatgacaacaaa
ggcatcttcaaggacatcccccaaggcgtggcagttagcagatatcactcattggcaggc
gagcctctttcacttcctgaagtcttggaggtcacggctagaacagaaaatggcatcatt
atgggagtcagacataaaaaccttaccgttgaaggtgttcagttccacccggagtcgatc
cttacggaagccggccatgttatggtcaggaacattctaaacatccagggtggtacctgg
gaggagcacgagaagctgagcaaggaaaagcgcgtgaaagggtcatctattctcgacaag
atttacgcacagagacagaaggatgttgacgagctttctgccacgccaggtttcacgctg
agggatttgcaaagcaactttaaccaaggtcttgccccagaggttcaagacttttacaca
aagctttcctcgggccccaaatccgctgttattgctgaaataaaaagggcttctccatcg
aaaggagacattgatatgaacgctatcgctgcagagcaaggcctgaaatacgctaaagct
ggtgcttcggctatttctgttttaacagaacctcattggttcaaaggcagcatacaagac
ctcgtgaacgtaagaagagccctggatatcgaatttaagaacgcgccccaggaccgtccc
tgtgtactgagaaaggagttcattttcagcaaataccagattttggaggctcgcttagct
ggtgcagacagcgtcttgctaatagtcaagatgctttcgcaggaccttctgctcgagctc
tacaactactcgaagtttgaggtcggcatcgagcctttggtggaagtgagttccaaagaa
gaaatgggcagagccctagaactgaatgccaaggttgttggcgtgaataacagagacttg
cattccttcaatgttgatctcaacacaacgagctcgctagcttcctctgttccagaggga
actatcctgctcgcgctgtctggtattacaagtggagctgatgctgagaagtacaagaag
gagggcgtgaagggtcttttggttggtgaagccttgatgagagctgctaacgttgactcc
ttaataaaagacctaagtgcctaa

DBGET integrated database retrieval system