KEGG   Lachancea thermotolerans: KLTH0B00968gHelp
Entry
KLTH0B00968g      CDS       T01117                                 

Definition
(RefSeq) KLTH0B00968p
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
lth  Lachancea thermotolerans
Pathway
lth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01230  Biosynthesis of amino acids
Module
lth_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KLTH0B00968g
Enzymes [BR:lth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KLTH0B00968g
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     KLTH0B00968g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS GATase Peptidase_C26 QRPTase_C Peripla_BP_2 VTC Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 8290660
NCBI-ProteinID: XP_002551834
UniProt: C5DC85
Position
B:complement(83522..84985)
Genome map
AA seq 487 aa AA seqDB search
MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLEEIDDLKPDCVFISPGP
GHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVSYAGEIVHGKTSQVTHDNK
GIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGIIMGVRHKNLTVEGVQFHPESI
LTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSILDKIYAQRQKDVDELSATPGFTL
RDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKRASPSKGDIDMNAIAAEQGLKYAKA
GASAISVLTEPHWFKGSIQDLVNVRRALDIEFKNAPQDRPCVLRKEFIFSKYQILEARLA
GADSVLLIVKMLSQDLLLELYNYSKFEVGIEPLVEVSSKEEMGRALELNAKVVGVNNRDL
HSFNVDLNTTSSLASSVPEGTILLALSGITSGADAEKYKKEGVKGLLVGEALMRAANVDS
LIKDLSA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtgttttcagcaaaaagaagagtagtcctaattgacaactatgactcgttcacctgg
aacctttatgagtacctatgccaggaaggagcagaggtgctagtctaccgtaacgaccaa
atcacgctagaggagattgatgatctaaagcccgactgtgtcttcatctcgccaggccca
ggccaccccagaactgactctggtatatccagagactgcgttcgtcacttcgcaggaaag
attcctgttgtcggtgtctgcatgggtttgcagtgtatgtttgacgtctttggtggaaca
gtatcctacgctggcgagatcgtgcacggaaagacatcgcaggtgactcatgacaacaaa
ggcatcttcaaggacatcccccaaggcgtggcagttagcagatatcactcattggcaggc
gagcctctttcacttcctgaagtcttggaggtcacggctagaacagaaaatggcatcatt
atgggagtcagacataaaaaccttaccgttgaaggtgttcagttccacccggagtcgatc
cttacggaagccggccatgttatggtcaggaacattctaaacatccagggtggtacctgg
gaggagcacgagaagctgagcaaggaaaagcgcgtgaaagggtcatctattctcgacaag
atttacgcacagagacagaaggatgttgacgagctttctgccacgccaggtttcacgctg
agggatttgcaaagcaactttaaccaaggtcttgccccagaggttcaagacttttacaca
aagctttcctcgggccccaaatccgctgttattgctgaaataaaaagggcttctccatcg
aaaggagacattgatatgaacgctatcgctgcagagcaaggcctgaaatacgctaaagct
ggtgcttcggctatttctgttttaacagaacctcattggttcaaaggcagcatacaagac
ctcgtgaacgtaagaagagccctggatatcgaatttaagaacgcgccccaggaccgtccc
tgtgtactgagaaaggagttcattttcagcaaataccagattttggaggctcgcttagct
ggtgcagacagcgtcttgctaatagtcaagatgctttcgcaggaccttctgctcgagctc
tacaactactcgaagtttgaggtcggcatcgagcctttggtggaagtgagttccaaagaa
gaaatgggcagagccctagaactgaatgccaaggttgttggcgtgaataacagagacttg
cattccttcaatgttgatctcaacacaacgagctcgctagcttcctctgttccagaggga
actatcctgctcgcgctgtctggtattacaagtggagctgatgctgagaagtacaagaag
gagggcgtgaagggtcttttggttggtgaagccttgatgagagctgctaacgttgactcc
ttaataaaagacctaagtgcctaa

DBGET integrated database retrieval system