KEGG   Lachancea thermotolerans: KLTH0B04752gHelp
Entry
KLTH0B04752g      CDS       T01117                                 

Definition
KLTH0B04752p
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lth  Lachancea thermotolerans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:lth03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:391353..392171
Genome map
AA seq 272 aa AA seqDB search
MSWDDEDFDLPSSAKNEPVLASWDDEFAETNDDDDAVLESWDAEPAAASAKKPTAPAKKP
AAKKDKKDAAASKPLLEIDTLDESTRRELLRKAEVDSDLNNAADLFGGLGVAEEHPRARA
LRKQQEEEALTRPAALTKDTPLDTHPLFQAESKKEYQELRKALAAAITPLNERSALNYSS
GLAIDLIRDVANPMSTESIRQTIATLNVLMKDKERQERLARLAKVKGGTATGGAGKKKAK
ATRANLGGAFKKDQEFDLETPAFDDFGEDDFM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggacgacgaagactttgacttaccctcttccgcgaaaaacgagcctgttctg
gcgtcttgggacgacgagttcgccgagaccaacgacgacgacgacgccgtgctggagtcg
tgggacgccgagcccgcggcggcgtcggccaagaagcccaccgcgcccgccaagaagccc
gcggccaagaaggacaagaaggacgcggccgctagcaagccgctgctggagatcgacacg
ctcgacgagagcactcgccgcgagctgctgcgcaaggccgaggtcgactcggacctgaat
aacgccgcagacctcttcggcgggctcggcgtcgccgaagagcacccccgcgcgcgcgcg
ctgcgcaagcagcaggaggaagaggccctgactcgccccgccgcgctcaccaaagacacc
ccgctcgacacccacccactgttccaggccgagtccaaaaaggagtaccaggagctgcgc
aaggcgctcgccgcggccatcaccccgctcaacgagcgctccgcgctcaactactcctct
ggcctcgccatcgacctgattcgcgacgtcgccaaccccatgtccaccgagtccatccgc
cagaccatcgccacgctcaacgttctcatgaaggacaaggagcgccaggagagactggcc
cgtctggccaaggtcaagggaggcaccgccacaggcggtgccggcaagaagaaggccaag
gctacgagggccaaccttggcggagccttcaagaaggaccaggagttcgacctggaaacc
ccagccttcgacgacttcggcgaggacgacttcatgtag

DBGET integrated database retrieval system