KEGG   Lachancea thermotolerans: KLTH0B04994gHelp
Entry
KLTH0B04994g      CDS       T01117                                 

Definition
KLTH0B04994p
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLTH0B04994g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:409558..411780
Genome map
AA seq 740 aa AA seqDB search
MGSKDVNSQRHQRLLRNIEITDNVHAVTANEIARNPDGYARQTRAKLAYHPRDEKTELQV
KPNLQWSLPDDAKEANALSSHVEFIKVDPVRGTFNKHIVKLRYDPRKLLSFDNLINNAAP
DPQKYHVDFEIREPETLFNRIDNECSKPYRCAIGDRRDYSTQRTTPSLKDREFFQSLLHK
AAPASYYNGNLLLAFNEAEEREITNPKKNKSRKAPSKIEYIYFRDHEIKTWYTAPYPEEF
NKNKILYICEYCLKYMNSRYVIHRHQLKCSLRHPPGNEIYREGNISIWEVDGRENVIYCQ
NLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDTGEESQFHFVGYFSKEKLTSTDYNLSCI
LTLPIYQRKGYGHFLVDFSYLLTRREYKWGTPEKPLSDLGLLSYRNFWKTKICEVLGELK
EEINHAEKKGEILHCSIEDLSNLTGMIPTDVVFGLEQIGALHYYKGESKLQFAIKIDNWS
LIDEVNNARKSKGYRALVPEKLVWKPMIFGPSCGINAMGTMIETTTGAARSTATGQQNGI
DTFKNSVSVLVNFLRDDIEDPRSMEAICQQKIHDQQGRHFDTSKINLMTLAFNAPVSRRL
KNSASSLVSVPNRYDDNETNNNTFSAPNGGADLGIVDPELLEETEQIDEEDEDNDLNETL
ADGDTIGDEEVKFSSTSEDEEEDEDEEIPGRGVSSSQGRFSRTRSGRAINSHRVIDSDEH
EEEHIATRRLRSMDPLLKNL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaaaggatgtcaatagtcagcgacatcagcgcctcttgcggaacattgaaatc
acagacaatgtacacgctgttacggcgaacgaaatagctcgcaaccccgatggctacgcc
cgtcaaacaagagcgaaattagcataccatcctcgtgatgagaaaaccgaactccaagtg
aagcccaatcttcagtggtcactaccagacgatgcaaaagaagcaaacgcactcagttcg
cacgtcgagtttatcaaggttgaccctgtgagaggcacattcaacaagcatatcgttaaa
ctgcgatatgacccaaggaaattgctgagtttcgacaacttgatcaacaacgcggcgccc
gatccccagaaataccatgttgacttcgagatacgtgagcctgaaactcttttcaacaga
atcgacaacgagtgttccaagccatacagatgcgcaatcggggacaggagagattactca
acacagagaacgacaccgtcgctgaaggaccgcgaattctttcaatctctgcttcataaa
gccgctcctgcaagctactacaatggcaacctacttctggcgttcaatgaagcagaagag
cgggaaatcaccaaccccaagaaaaacaagtccaggaaagccccatcgaagattgagtac
atttacttccgtgaccatgagataaaaacgtggtatacagcgccgtaccccgaagagttc
aacaaaaacaagattttgtatatctgcgagtattgcctcaagtacatgaactcgcgttac
gttatacaccggcaccaattaaaatgttcgcttcgccatccgcctgggaatgaaatctat
agagaaggaaacatatccatttgggaagtggacggccgtgaaaatgtcatatattgtcaa
aatctgtgtctactggccaaactgtttctgaactcgaaaactctctattacgatgtcgaa
ccattcattttttatgtcctcaccgaacgcgaggatacgggcgaggagtcgcaatttcat
ttcgttggatacttttcgaaagaaaagctgacttcaactgattacaacttgagttgtatt
ttaacacttccaatttatcaaagaaaaggatatggtcattttcttgttgatttctcatac
ctgctcacaagaagagagtataaatggggcacccctgaaaagcctctgtcagatcttgga
cttctttcatatcggaacttttggaagacaaagatatgcgaagtcctgggagagctgaag
gaagaaattaatcatgcagagaagaagggcgagattctgcattgtagtattgaagacctg
tccaatctgacgggaatgataccaactgatgtcgttttcggactagagcaaataggcgcc
cttcattactacaaaggagaaagcaagctgcaatttgcgatcaaaatcgacaattggtct
ctcattgatgaggtcaacaatgctagaaagtctaagggctatcgtgctcttgtgccagaa
aaattggtttggaagccaatgatatttggcccctcctgtggcatcaatgctatggggaca
atgattgaaacaacaactggagcggcacggagtacggctactggtcagcagaatggtatc
gatactttcaaaaatagcgtttccgtgttggttaatttcctacgggatgacatagaagat
cctaggagcatggaagctatatgccaacaaaaaattcatgaccagcaagggcgccacttt
gacacttccaaaataaaccttatgaccttagcattcaacgcgcctgtatctcgcaggcta
aaaaattctgcatctagccttgtttcggttcctaatcgttacgacgataatgaaactaac
aataacacgttctcagctcccaatggcggcgctgatctgggtattgtagatccagagcta
ctcgaagaaacggagcagattgatgaagaggatgaagataatgacttgaacgaaacactt
gcagacggcgataccataggagacgaagaagttaaattctcaagcacttcagaggatgag
gaagaggatgaagacgaggaaattcccgggcgaggtgtgtccagctcccaaggaaggttc
agcagaactaggagtggacgtgcgatcaatagccaccgggtcattgacagcgacgaacat
gaggaagagcatatcgccacaagacgacttcgtagcatggacccactactaaaaaatttg
taa

DBGET integrated database retrieval system