KEGG   Lachancea thermotolerans: KLTH0B07150gHelp
Entry
KLTH0B07150g      CDS       T01117                                 

Definition
KLTH0B07150p
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(574195..576465)
Genome map
AA seq 756 aa AA seqDB search
MQEHDAVKPLVERLLAQPLQFKPATAPDSVEGKPVSCVVIGSSRPAAHHPTRRDGTNADA
SGRTQGDGRKANGTSGNANGRRPVPKNFSEALQMYTARKQIPSDVELSDGKYQSSSDGEG
AGEDVVDAPDAAGAQSESGESSDSAAEEFHEAHEYVEDGSSDPGSGADAVASTGEDLGED
LGEDLGEDLGEDLGEDLGEDVGEGLGEDLGEDPEEGAKENAGNSKPETDADEREASLGSV
SDQDDQDEEDADFQDDGTEDSELEGPDGNITDSEKAGLMREAQEYAEMASLADARKKTEP
AGEDNGNAEEESAHEENEEELKHKQPSSKRASPTPPTVLSDMDRFYQFNEKANDRGANNS
TRILKNWGPQLSTMKPKGLLNHGVTCYTNAAVQALIHIPAIQHYLFDVLRGEYKSTISPN
SVTQVLAETSKRMWSTDASKNQFINPKKLIGRLEDINCMMSEWQQEDSHEYFMSLISRLQ
EDSVPRGHKLTESILYDIFGGMLRQEVTCKSCGEVSKTEQPIYDISLHLKGKKNSDSADT
AKNSSDFEEEPQRRFSIEKSIRDFFNPELIKVDKANKEGYVCEKCHKTTNASKHNFILRA
PETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDVTEFCENSKTTLPVKYQLISVVVHEGRS
LTSGHYIAHCKQPDGSWSTYDDEYINKISERQMLKEPGAYYLVYTRLTPRSVPLPQGPSV
SSSSAAAATNRAEGTPKSSSKRKKSKNKNKKRCYNK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacacgacgcggtcaagccgctggtggagagactacttgctcagccgttgcag
tttaagcccgctacggcgcctgatagcgtcgaaggaaaacccgtttcgtgcgtggtgatc
ggatcttcgcgcccagcggcgcatcatccaactaggcgcgatggcaccaacgccgacgcg
tctggccgcacgcagggcgacggaagaaaggcgaacgggacgtcgggcaacgccaacggc
agaagaccagtgcccaagaacttttcggaggcactgcagatgtacacggcgcggaaacaa
atccctagcgacgtggagctgagcgacgggaagtaccagagctcgagcgacggcgaggga
gcgggcgaagatgttgtcgacgcccctgacgcggccggtgcacagagcgagtctggcgag
tctagcgactccgccgcggaggaattccacgaagcacacgagtatgtcgaggacgggtct
tctgaccccggaagtggcgccgacgcggtggcgagcacaggcgaagatctaggggaagac
cttggtgaggaccttggtgaggatctcggtgaggaccttggcgaggaccttggtgaggat
gtgggagaaggcctgggagaggatctgggagaggaccctgaagagggagctaaagaaaat
gccggtaactcgaagccagaaacagatgccgatgagcgtgaggcatcgctgggcagcgtc
tccgaccaagatgaccaggacgaagaagatgctgatttccaagacgatggcaccgaggac
tcagagttggagggccccgacggcaacatcacagatagcgagaaagcggggctgatgcgt
gaagctcaagagtacgccgagatggccagccttgccgatgctcgcaaaaagaccgagcca
gccggcgaggacaacggcaacgctgaggaggagagtgcccacgaagagaatgaagaggag
ctaaagcacaagcagccttccagcaagcgcgcctcccccactcctccaactgtcctttca
gacatggatcgcttctatcagttcaatgagaaggcaaacgatcgtggcgccaacaactct
acacggattctgaaaaactgggggcctcagctttccaccatgaaaccaaaggggctgctc
aaccacggggtcacctgttacaccaacgcagctgtgcaggctttgatccatattccggcc
attcagcactacctgtttgatgttttgcgtggagagtacaaatctaccatatcaccaaat
tctgtgacccaggtgcttgcggagacatcaaaacgtatgtggtctacagacgcttccaag
aaccagtttatcaacccaaagaagctaatcgggagactggaggatatcaactgcatgatg
agtgaatggcaacaagaagactcgcatgagtatttcatgtctctaatctcgaggctccaa
gaggacagcgttccacgcggccacaagctaacagaaagtattctttacgacattttcggc
ggtatgctgaggcaggaggttacctgtaaaagctgtggcgaagtgtccaaaacagaacaa
ccaatatacgacatctccttacatctgaagggcaagaaaaacagcgactccgccgatacc
gctaagaatagctcagactttgaagaggaaccacaacgccgcttctccattgaaaagtca
attagagattttttcaatccggagctcatcaaagttgacaaggctaataaagaggggtac
gtgtgcgaaaagtgccacaagaccactaacgcttcgaaacataattttatcttgagagcc
ccggaaactctactagtgcacctgaagaaattccgcttcaatggaacatcgtcttccaag
ttgaagcaggcagtttcctaccctatgttcctggacgtcactgagttctgcgaaaattct
aagactaccttgccagtgaaatatcaactaataagcgttgttgttcacgagggccgctcc
ttgacctccggccattatattgctcactgcaagcagcctgacggctcttggtcgacgtat
gatgacgagtacatcaacaagatctccgaaaggcagatgctgaaggaacccggcgcctat
tatctggtatacacgcgtttgacacctagaagtgtacctcttccccagggcccaagcgtt
tcgtcatccagtgcagctgcagctaccaacagagcagaaggcactcctaagagctcctct
aagagaaagaagtccaaaaacaaaaacaaaaagagatgctacaacaaataa

DBGET integrated database retrieval system