KEGG   Lachancea thermotolerans: KLTH0B08800gHelp
Entry
KLTH0B08800g      CDS       T01117                                 

Definition
KLTH0B08800p
Orthology
K07204  
regulatory associated protein of mTOR
Organism
lth  Lachancea thermotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(712793..717340)
Genome map
AA seq 1515 aa AA seqDB search
MPTTYGPQPLRKLNTETRHGFGDQYSSEQYLENLENDFMFYFDDKRHRTNGNPTSPEVKA
KDESHYYQPIPDWKIVKERQKTVSAALLLCLNLGVDPPDVAKTHPCARLESWVDPLNFQD
SKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRASKDERILFHYNGHG
VPQPTASGEMWVFNRGYTQYIPVSLYDLQTWLGAPCIYVYDCNSAGNIVANFQTFVQKRI
KDDQDGNHDPAAPSPTQAYTECIQLASCRANELLPMKPELPADLFTCCLTCPIKISVEIF
LMQSPLRESKYSVLFQDYDSRTHRSGEQSSSAKPNVTIPGKLSDRRTPLGELNWIFTAIT
DTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPWFNCHPVSDPELPDSIADHPMW
KSWDLAIDEVLTKLVDDLQNVPLASADLELQPSLQEQQVSDTSIDDPLHSKAAAGTLSTM
SLANHQAGSLSQVSQHLSQQQLLQHQHQQQQLQQQQQQQQFTGFFEQNLTAFELWLKYGS
NTRHPPEQLPIVLQVLLSQVHRVRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPA
PELRPILVFIWARIMSIDYKNTQAELIKEKGYLYFVKILVPELGMHPQPGSAPQLQRTIS
GGGLTMNASTSIGTQRYQFYQNFQNANNPGVAMANNTTDEQKAMAMFVLSSFLRDFSLGQ
KYCSSLELLGKICYYVETSDVPLLRQWCIVLMGQLYLKNPFNKYLCMTCGFLDKIYTSMK
DPIPEIRCAALLAFSMFISEKNDAEMALQMQQEMQQQAQQLQVQLQTLQGGQMQRQQAQA
ERQLQQLQASLSQMRTMDSRKLKQDEIKMTIEALGLVNDGSPLVRKELIISLSRIVHRYI
NFFFVIAFNELCDEISQLESTGDSAALESKQSIAHGSIFNTVWKSLLILAEDPYLENKTL
AQQVVDYVFTKLNVHSQLNEVVLLMELYLVKHTSCNATGHGATTVSILPTAKRPLSLSAN
KREATSNSETPKSGIFKRSISLNGLLKALGWEQDQEDSSQETPSNRSFGRLQGNNLLTVP
YGVSPSATTPRYKKPKGPIDMPLKSSFLDYSREYFQEPQMKKQEADEPGSVEYTSRLWRR
NRNESIIQRTQAQKRLALYGDWSNKIGTLDNKTQPKLLKFSQFENYIACSDDRDNISIFD
WVDKSKLSTFSNGNPFGTKITDMSYLNEDDVPLLLAGSSDGIVKIYKNFQDLEELELVSS
WRGLTDLLLTPRSTGLLTEWQQSRGSLLVTGDAKIIRVWDALTETIEVDIPAKSSSLITS
ITSDQLSGHMFVTGFSDGSLRAYDRRVDPRDSMVRLWRSGDGKSNFGINNIHLQRGGYRE
LVSGTENGLVELWDLRYQNSIGKFKDEGDKSSSMTTMTSMKVHEHAPVIATGTKSLKIWT
TSGDLLSSFKNNTPAHAGGVAGTLATGISASRISSSFISTMAFHPHEMILAAANSHNSSI
NIYECYEGKTDYLYY
NT seq 4548 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgacctatgggcctcagcccctccgtaaactcaatacggaaacgaggcatggg
ttcggcgatcaatattcttcggaacagtacctcgagaacctagaaaatgactttatgttt
tattttgatgataaaaggcacaggaccaacggcaaccctacttcacctgaagttaaggcc
aaagatgaaagccactactatcagcccatcccagattggaagatagtaaaagaacgacaa
aaaaccgtttccgcagcgttactgctgtgtctgaatcttggagttgatcctcctgatgtt
gccaaaacacatccatgcgcgagattggagtcctgggttgatccactcaatttccaagac
tcaaaaaaggccattgagcaaattgggaagaacctgcagtcacagtacgaaactctatct
ttaaggacccggtataagcaatctttagatccctgcgtcgaagatgtgaaaaggttttgt
aactccttgcggcgggcctccaaggatgagagaatcctttttcattacaacggccacggc
gtccctcaacctacggcttctggagagatgtgggtctttaatcgcggatacacacaatac
attccggtgtcactgtacgacctccagacctggcttggcgccccctgcatatatgtctat
gactgcaacagtgctggcaatatagtcgccaactttcaaacatttgtacaaaagagaatt
aaagacgatcaggatggaaatcatgaccctgcggcaccttcgcccactcaggcctacact
gagtgtattcagttggcgtcctgtagagcgaatgaattgctaccaatgaagccagagctt
ccagcagatctctttacatgctgcttaacctgcccaatcaaaatcagtgttgagatcttt
ctcatgcaatctccattgagagagtccaagtattcggttctgtttcaagactacgattca
cgaactcatagatcaggagagcaatcgtcttccgcaaagcctaatgttacaattcctggc
aagctatccgataggagaactccactgggtgagttaaattggatcttcactgcaataacg
gataccatagcctggacctccctaccgcgcccgctattcaaaaagcttttcagacatgat
ctcatggtcgctgctctctttaggaattttctccttgcaaagcgcattatgccttggttc
aattgccacccggtttctgatccagagcttcctgattcgatagcagatcacccaatgtgg
aagtcttgggacttagctattgacgaggtcttaacaaaacttgttgacgaccttcaaaat
gtgccattggcctctgcagacctagaactgcagccatctctgcaagagcagcaggtatcg
gatacatcgatcgatgacccactgcactctaaagcggctgcaggcactttaagcacgatg
tcattagcgaatcaccaagcaggaagcctgtcacaggtgtcgcaacatctctctcaacag
cagctattacaacatcagcaccaacaacagcaactgcagcagcaacaacagcagcaacag
tttacaggattttttgagcagaacttgactgcttttgaactctggcttaagtatgggtca
aacacccgccacccaccagagcaactgccaatcgttttacaggttctgttatctcaggtt
catcgtgttcgggcgctggtcttgctttcccggtttttggatttaggaccctgggccgtc
tatctttcattatcaattgggatatttccatatgtcttgaagcttttacaaagccctgct
ccggaactcaggccaattctggttttcatatgggccagaattatgtccatagactataaa
aacacccaggccgagttgattaaagaaaagggatatctttactttgtcaaaatattagtg
cccgagttgggtatgcatccgcagccgggaagtgcccctcaacttcaaaggactattagt
ggtggcggtttgactatgaatgctagcacaagcatcggaacacagcgttatcagttttac
caaaatttccaaaatgccaataatcctggagtagccatggcaaacaacacgactgatgaa
cagaaggccatggctatgtttgtgctctcatccttcctacgcgacttttccctggggcaa
aaatattgctcctcattagaacttctcggcaagatatgttattatgttgaaacgtccgat
gttccgctactacggcagtggtgcatcgtgctcatgggccaattatatttaaagaaccct
ttcaacaaatatttgtgcatgacttgcgggtttttagacaaaatctacacctctatgaag
gatcccattcctgagattcgttgtgccgcgttgttagctttcagcatgttcatttcagag
aagaatgatgccgagatggctcttcagatgcaacaagaaatgcaacagcaggcacaacag
cttcaagttcagcttcaaacgttacaaggtggtcaaatgcagcggcagcaagctcaagct
gagcgccagctgcaacaacttcaagcttcgctgtctcagatgagaactatggattcaagg
aaactgaaacaagacgagatcaaaatgactattgaggccttaggcttggtaaatgacggg
tcaccgttggtgaggaaagagctaatcatctccttgtctcgtattgtgcaccggtacatc
aacttcttttttgttatagctttcaatgagttatgtgatgagatttctcagctggagtcc
acaggtgacagtgcagcattagaaagcaagcagtcgatagctcatgggtccattttcaac
acagtttggaagtcccttctcattctcgcagaggacccctacctcgaaaacaaaactttg
gcgcaacaggtagtggattatgttttcaccaagctcaatgtccactctcagctcaatgaa
gtggtattgttaatggaactatatttggtgaagcacacctcctgcaatgccactggtcac
ggagcaacaacagtatctatacttcccacagcaaaaaggcccctcagtttgtctgcgaac
aaaagggaggctactagcaactcagaaactccaaaatcaggtattttcaaaagaagcatt
tctttgaatggacttctgaaagctctcggctgggagcaggaccaggaggattcttcgcag
gaaactccctctaaccgatcattcggaagacttcagggcaataatcttttgactgtaccg
tatggagtatctccttcggcgactaccccaaggtacaaaaaacctaaaggccctattgat
atgcctctgaaaagcagctttttggactactcacgggagtactttcaagaacctcagatg
aaaaaacaagaagccgacgaacctggtagtgttgagtatacctcgagactctggcgcaga
aacagaaatgagtccataatccagaggacccaggctcagaagagactggcactctatggg
gactggtctaacaagatcggaacattagataacaaaacacagccaaagctgctaaaattc
agccaattcgagaactacattgcatgctccgacgacagagacaatatttcgatttttgat
tgggttgataaaagcaagctttctacgttctcaaatggcaatccctttggtaccaaaatt
acagacatgagttacctaaatgaagatgatgtgcccctgcttctcgcaggctcttctgac
ggtatagtcaaaatttacaagaactttcaagaccttgaggagctagaacttgtttcctcg
tggaggggccttactgacttactgttgacaccgaggtcaactgggttgctaacagagtgg
cagcagagcaggggatcgctcttggtgactggagatgctaaaataatcagagtatgggat
gccttgaccgagaccattgaagttgatatacctgcgaaatcttcatcgctcatcacttct
attacgtcggaccaactttcagggcacatgttcgtaacaggtttctccgatggatctctt
cgagcatatgatcgtcgcgtcgaccccagagattccatggtgagactatggagatctggg
gacggaaaatccaattttgggataaacaacatccacttacagaggggcgggtaccgtgaa
ctggttagcggaaccgaaaatggtcttgtagaactctgggatctccggtaccaaaactca
atagggaagtttaaagatgaaggtgacaagagctcgtccatgactaccatgacttcgatg
aaggtgcacgagcatgcgcctgtgatcgccactggtactaaatcgttaaagatctggact
acttcaggtgatctgctgtcgtcctttaagaacaatacgccagcacacgcaggcggtgtt
gctggcacactcgccacgggaataagcgcatcaagaatttcaagttcgtttatttccacg
atggctttccatcctcatgagatgatcctggccgctgcaaactctcacaactcgagcatc
aatatctacgaatgttatgaaggaaagacagactacctgtactactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system