KEGG   Lachancea thermotolerans: KLTH0B09064gHelp
Entry
KLTH0B09064g      CDS       T01117                                 

Definition
KLTH0B09064p
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lth  Lachancea thermotolerans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KLTH0B09064g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KLTH0B09064g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(738472..739206)
Genome map
AA seq 244 aa AA seqDB search
MENKHLAGLIERQDTPLRTRPASPYTLNPPVEADGLSWPSLGSRVRSEESPEETQQRTDR
IAEAVKVILSELGEDVSREGLLETPQRYAKAMMYFTKGYQHNIINDVIKNAVFEEDHDEM
VIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLARLAEMYARRLQVQERLTKQI
AMALSEILKPRGVAVVIEAAHMCMVSRGVQKTGSSTMTSCMLGCFREAHKTREEFLNLLN
RRSI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaagcatcttgccgggctcatagagagacaagacacacctttgagaacgagg
cctgcctcgccctacactctgaatccaccagtggaagcagatgggttgtcatggccatct
ctcggctccagagtccgctcggaagagtcgccggaagaaactcagcaaagaactgaccgc
atcgcggaagcagtcaaggtcattctgtcagaattgggtgaagacgtgtccagagaaggg
ttgttggagacgcctcagcggtacgccaaggcaatgatgtacttcaccaagggttaccag
cacaatattatcaacgacgtgatcaaaaacgctgttttcgaggaggatcacgatgaaatg
gtgattgtgcgcgatatagagatatattctctgtgtgagcatcatttggtgcctttcttt
ggcaaggttcacatcggctacattcccaacaagaaggtactgggtttaagtaagctggcg
cgccttgctgagatgtacgcgcgcagactgcaagtgcaagagcggctgacgaagcaaatc
gcaatggcattaagcgaaatattgaagccaagaggtgtggcagtggttattgaagctgct
cacatgtgcatggtgtctaggggcgttcaaaagacagggtcttcaaccatgacgtcgtgt
atgctgggctgttttagggaagcccacaagaccagggaagaattcctcaatctgctgaat
aggagaagcatatag

DBGET integrated database retrieval system