KEGG   Lachancea thermotolerans: KLTH0B09944gHelp
Entry
KLTH0B09944g      CDS       T01117                                 

Definition
KLTH0B09944p
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLTH0B09944g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0B09944g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(826050..829619)
Genome map
AA seq 1189 aa AA seqDB search
MSEKPAFQENVGELIDLGKGISDVLPELESQETECEGAFTWHIGNWSQLKQDKHVSPRFR
IGEYEWDVLLFPQGNHNSGISMYLEPHPEEKFNEEKQCLEPTDPDWHVCAQFAIGISKPG
EDTKCQLFNVSHHRFSATDTDWGFANYIELESLKRRTSSKNSGFLSNGRLNVSVFVRILK
DPTGVLWHNFMNYDSKKLTGFIGLKNQGATCYLNSLLQSYFFTKLFRKIVYKIPSENESP
NDSVLLALQRSFYLLQKSNETLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMK
GTEVEGALNELFVGKMKSYIRCINVDYESSRVEDFWDIQLNVKNLKGVQESFDNYVEVEI
MDGENQYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETID
LSPYLDPDVLKKNPGPCVYNLHGVLVHSGEISVGHYYAMIKPDVGDQWFRFDDDKVWRVT
KEQAFDENFGHEPLPDDKLRSLTREQYQNYLIARQTSAYMLVYIREDMEKNVLEDVSDTD
VPQHIVTSIEKELKEREQKRKELEEMHLYTKVNIHSMSNFVNYQGFDLSPNERSKLYSSE
LHDESEYASSLKILKTTKLRDVKSEISSKLNLPRTHRVNYWIMSYRKNYTLRLDSILAPE
LDSLSLEQVIHKMGISRATAIDFFVEEPYLELAFLNELLKANIIPPSRLTSESVLKIRKA
AYEENFPESSKYLSSPEEDSPKVLVFLKVFDTEVRRLEGFAHTLVNRTDKVSKLVELAGH
FCSVNTTEFFYEEFQPDTIEPIEREMQFVASELVDGDILSFSTTQSRQNLSSQPPSLLEY
YDYLRYRIKISLTRTVNAEEEYVATDESNNDGPLELWISAKASYQELAQKISQRTGISAH
FIRTFAIYGNGRFALKWDCKISDFLVKNYTRDSIPPFEYEVLSIPLKEFEHLRSIKFYWL
SDSYVHYQLYEFRIANSCTIGEFMDKLQQRLHFDDEQKSKILIWTNCDFKFQGILSEENV
FEELSESFLFFGRILPEELALVKQLEASSPENIDSMDETEEEDLSIVTKSANPTEGKLVI
VIQYFKDLDNRHGISFLFNLLPNENCLQTWDRLHAKFGLGHKEFSKIKLGITVSSEAGLT
FKSFQNFTDQELSEIILFDVLNNLDYICMDHPDRTRTQTYHDRPMVIKN
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaacctgcttttcaggagaatgttggtgaactaatcgacctgggaaaaggg
atcagtgatgtgctaccggagttggaatcacaagagactgaatgtgagggagcattcacg
tggcatatcgggaactggagtcaattgaagcaggacaaacatgtttctcctcgctttagg
ataggtgaatacgagtgggatgtgcttctgtttccacaaggtaaccacaacagcggaatt
tcgatgtatcttgagcctcatccagaagaaaagttcaacgaggagaaacagtgcctagag
ccaactgacccagattggcatgtgtgtgcacagtttgctatcggcatctctaagccagga
gaagatacaaagtgccagcttttcaatgtttcacatcacaggttcagtgctactgacaca
gattggggcttcgctaactatattgagctagaaagtctgaaaaggcgcacctcttccaaa
aattcaggatttctatcaaatggccgactgaacgtgtcagtttttgtgagaattttaaaa
gaccccactggagtcttatggcataattttatgaactatgactctaaaaagctaacaggc
tttattggactaaaaaaccaaggtgcgacatgttacttgaactcccttctccagtcgtac
ttttttaccaagctcttcagaaagatagtttataagatcccttccgaaaacgaatctcct
aatgacagcgttttactagcgcttcagcgctctttctacctccttcaaaagtctaatgag
accttagacacattggagctaacgaggtcatttggatgggataccggcgatgccttcacc
cagcatgacgttcaagaactgaatcgtattttaatggacaggcttgaaacacgtatgaag
ggaacagaagtcgaaggggcactgaacgagcttttcgttggaaaaatgaaaagttacatt
aggtgcatcaacgtagattacgaatcctcgcgggttgaagacttctgggacatacagctg
aacgtcaagaatttaaaaggggtgcaagaatcttttgacaattatgttgaggttgaaata
atggatggcgaaaatcagtacgcagcacaggattatgggttgcaagatgccaagaaaggt
gttgtgttcgaaagctttccctctgtccttcatttgcaactgaaaaggtttgaatatgac
ttcaactacgaccagttggtcaaaatcaatgatagatatgagtttccagaaactattgac
ttgtctccttaccttgatccagatgttttgaaaaaaaatcctggtccttgcgtttacaat
cttcatggagttttagttcactccggggagatttctgtcggacactattacgcaatgatt
aaaccagatgtgggggaccaatggtttagattcgatgacgacaaagtttggcgtgttacc
aaagagcaagcttttgacgaaaactttggtcatgaaccactgccagatgacaaacttaga
tcattgacccgtgagcaataccaaaattatctgatagcgcgccaaacaagtgcttacatg
cttgtctacatacgagaggatatggagaaaaacgtccttgaggacgtgtccgatacagat
gtccctcaacatattgtgaccagcattgagaaagaattaaaagagcgcgaacaaaagcgc
aaggagcttgaagaaatgcatttgtacactaaggtcaatattcattccatgagcaatttt
gtgaactatcaaggatttgatttatcacccaatgagcgctcgaagttatacagttctgaa
ctgcatgatgaaagtgaatatgcttcttctctgaaaatcttgaaaactacaaaacttcgg
gatgttaaaagcgagataagcagcaaattgaatttaccaagaacgcatagagttaactat
tggattatgagttatagaaagaattacacactgcggctcgattctattcttgcacctgaa
ctcgacagtttatcgttagagcaagttatacacaaaatggggatctcgcgtgcaactgcg
attgatttttttgttgaagagccgtacttggaactcgcatttttgaatgagttgctcaag
gccaatataattcctccttcaagacttacatcggaaagcgttctcaagataagaaaggct
gcatacgaagagaattttcctgagtcctcgaaatatctaagttctccagaagaagattcc
cctaaagttctagtttttctaaaagtttttgataccgaagttcggcgtttggaagggttt
gctcacacgcttgtcaatagaactgataaggtttccaaactggtagagttagcaggccac
ttctgttctgttaacactactgaatttttttatgaagaatttcagccggacacaatcgaa
ccaatcgagagggagatgcaatttgtggcatcagaattagtagatggtgatattctttcg
ttctccactacgcaatctagacaaaacctttcgtctcagcccccctctcttctagaatac
tatgactatctgaggtacagaatcaaaataagtcttacgcgaaccgttaacgccgaagaa
gagtacgttgctactgatgaaagcaataacgatggccccctcgaattgtggatatctgcc
aaggcaagctaccaagagcttgctcaaaaaatttcacaaagaacgggaataagtgcacat
ttcattcgtacttttgccatctatgggaacgggcgctttgctctcaagtgggactgcaaa
atttcggactttttggtcaaaaattacactagagattccataccgccatttgaatatgag
gtgctatcaattcctttgaaagaatttgagcatctcagatccatcaagttttactggttg
agtgacagctacgtccactaccaactttatgaatttaggattgcgaactcatgtactatt
ggtgagtttatggataagctgcagcagaggttgcactttgatgacgagcaaaagagcaaa
atattgatatggacaaactgcgacttcaagtttcaaggtatattgtcagaagagaacgtg
tttgaagaattgagcgagtcatttttatttttcggtcgaattttacctgaggagctagca
cttgtgaaacaactggaagcatcttcaccagaaaacattgactcgatggatgaaactgaa
gaagaagatctaagtattgtaacgaaaagtgcaaaccccacagaaggaaagcttgtgata
gtcattcaatatttcaaagacctagacaacagacatggaatatcatttttgttcaatttg
ttgcccaatgagaactgcttacagacctgggaccgcttgcacgcaaagtttggactaggg
cacaaagagttctcgaagatcaagcttggaattacagtaagttccgaagctggtctaaca
ttcaagtccttccagaactttactgatcaagaacttagcgagatcatactatttgatgtt
ttgaataatttggactatatctgcatggatcatccagatcggacaaggacccaaacatat
catgataggcctatggtaataaaaaactag

DBGET integrated database retrieval system