KEGG   Lachancea thermotolerans: KLTH0C02486gHelp
Entry
KLTH0C02486g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C02486p
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
lth  Lachancea thermotolerans
Pathway
Regulation of mitophagy - yeast
Longevity regulating pathway - multiple species
Insulin resistance
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    KLTH0C02486g
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    KLTH0C02486g
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    KLTH0C02486g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KLTH0C02486g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   KLTH0C02486g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(217025..224428)
Genome map
AA seq 2467 aa AA seqDB search
MLRMKHDLGRRKKLISNGQNGEIAKDSSVGSGAAGVASVVAGTSGAAEAAEAAAMTVGGS
LGAGDADSDTTFLAFTMIFNKLKNPSAQERSTASFELKNSLVSLAREVSTEQFQRFSNDI
NNKIFELIHGTTSFEKLGGVLAVDTLIEFYAQSDELPNQTSRLANYLRVLVPSNDVEVMR
AAAATLGKLAIPGGTLTSDFVDFEVKTCIEWLTTSPENSSSNFKQELRKHASLLIITAIA
DNSPYLLYPYINSILDNIWRALRDTKLAIRVDAAQTLYKCMAIIQERDSKLTKKWFQRLF
EGCAYGLQLNGNEAIHATLLVYRQLLSLQGSHLQEQFDEMYEMTMRYKDHKYNVIRKEIY
AILPLLASADPQLFTDKYLDHVMIHYLTLLKNMHASPTNNSDRAAISVSIGDIAQQVGSN
IAPYMDSILDNVRDGLMTKFKLRKEFEKELFYCVAKLACAVGPVLAKYLNRDLLDLMLAC
PLSDHMQTTFSTIIEKIPALCPTINEKVLDMICLALSGEKFSPPGAPVPLKPLSPEKARH
YRDHLIFKKTGELNDDSLDVHYLNQALTMLHKINYRYSLVELVRLITISYIEHENPQVRK
LAALTSCDLFVKDSICKQTSLRALNTVSEVLSKLLTVAITDPVVEIRFEVLRHLDASFDP
QLSQPDNVRLLFMALNDEVFAIQMEAMKIIGRLSIVNPAYVIPSLRKTLLQLLSQLSHSN
MSRKKEESASLISNLISSSKDITKPYIEPILDVLLPKCKDASSAVASTALRAVGELAVVG
GEEMTLFLDQLMPLIIDTFQDQSNSFKRDAALKTLGQLSASSGYVIKPLLDYPQLLGVLI
SILKSESSQNIRRETVRLIGILGALDPYKQREVERTSNTNITAEQNAPRIDVALLMQGMS
PSNDEYYPTVVIATLMKILKDPSLSSHHTSAIQAIMHIFQTLGVRCVSFLKQIIPGIINV
MRTCPPSLLEFYFQQLGILISIVNQHIRPFVAEIFEVVKEFFPIVKLQITIISVIESFSK
ALNGEFKLFLPTTLTLFLDVLEKDKSSRKSVSVRILKSLVVFDSNLEEFSHLVIPTIVRI
AEYGAGSLNRVAIITLGRLAKTVNLSEMSSRIVQALIRVLNSGNADLIKATMNTLSLLLL
QMDVDFAVFIPIINKTLVKNQIQHTVYDQLVNKLLNHEALPTNIIIDRDFDVVSKEIAEI
ELPSKKLPVNQLVLKNAWDCSQQRTKEDWQEWIRRLAVQLLKESPSHALRACSGLAGIYY
PLARELFNASFASCWTELYTQYQEDLVSSLCMALSSPNNPPEIHQTLLNLVEFMEHDDKS
LPIPVPTLGEYAQKCHAYAKSLHYKELAFIQEPSTSTIESLISINNQLHQTDAAIGILKH
AQQHHDLQLKETWYEKLQRWEDALNAYNQRELAGEDSIEVRMGKMRSLHALGEWDRLSEM
AAEKWSTSSMEVKRIIAPLAAGADWGLGQWDRIGQYIDAMKSHSPDKAFFDAILCSHRNN
FDEAEKHIFEARDLLVTEISALVNESYNRAYSVIVRAQMISELGEIIEYKKLPPASEKRA
AIRKTWNKRLLGCQKNVDVWQRILRVRSLVVKPKQDMQVWIKFANLCRKSGRMGLAQKAL
NSLLEDGGDPDHPNTARAPPPVVYAQLKYMWATGSQKEALRHLISFTSRVAHDLGLDPSN
MIAQSVPQNSTIPAHHIEEYTKLLARCFLKQGEWRVSLQTNWRMENPDAILGSYLLATHF
DNRWYKAWHNWALANFDVISISSRGNDDKMLQNGTGEFGMNDSALQEPESSLEVENDGNT
LNKTLFPPELVQRHVVPAIKGFFHSILLSESNSLQDTLRLLTLWFKFGGIPEAAQAMHEG
FNLIKIDNWLDVVPQLITRIHQPNQTVSMSLLSLLSDLGKAHPQALVYPLTVAIKSESVS
RQKAALSIIAKMRIHSSILVDHAEIVSHELIRVAVLWHELWYEGLEDASRQFFGEHNTER
MFATLEPLHEMLKRGPATLREISFQNSFGRDLNDAYEWVMNYKRNKDITNLNQAWDIYYN
VFRRISRQLPQLQTLELQHVSPKLLAAHDLSLAVPGTYQAGKPIVRISYFEPVFYVISSK
QRPRRLSVKGSDGKDYQYLLKGHEDIRQDNLVMQLFGLVNTLLQNDPECFQRHLDIQRYS
AIPLSPKSGLLGWVNNSDTFHVLIREHREARKIPLNIEHRIMLQMAPDYDNLTLLQKIEV
FTYALDNTRGQDLYKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLML
DRITGKVVHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRV
LRDNKESLMAILEAFAYDPLINWGFDLPTQTIAEQTGTELPLANPSELLRKGTISIEEAA
KMEIRQKAEIRNARAMLVLKRITDKLTGNDFRRFRSLDVPDQVEKLIQQATSVENLCQHY
IGWCSFW
NT seq 7404 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggatgaagcatgacttgggaaggaggaagaaacttatctctaacggacagaac
ggggagatagctaaagactcgtcagtaggctcgggggcggccggtgtcgcttccgttgtg
gcgggtactagcggagcagcggaagctgcggaagccgctgcgatgacagtaggcggatcg
ctaggggcaggggacgcagactcagacacaacatttttggcatttacaatgatcttcaac
aagctgaaaaaccctagcgcacaagaacgcagtacggcgtcctttgaactcaagaacagt
ctggtgtcgctggcgcgtgaagtctcaacagagcagtttcaacgattcagcaatgacatt
aacaacaaaatcttcgaactgattcacggtacgacatccttcgagaaattgggtggcgtg
ctagccgttgacaccctgatcgaattctatgcacagtcagatgaactgcctaaccagaca
tcgaggcttgctaactaccttcgcgttttagttccttcaaacgacgtagaggtaatgcgt
gccgctgctgcaactttgggaaagcttgcaatccctggcggtaccctcacgtcagatttt
gtcgattttgaggtcaaaacttgcatcgagtggctgactacgtcgccagaaaactcttca
tctaactttaagcaagagctccgcaagcatgcttccttgctcatcattacggccattgcc
gataactcgccatacctgctgtacccttacattaactctattttagacaacatatggaga
gcccttagggatacgaagctcgctatccgcgttgacgcagctcaaacactctacaaatgc
atggcaataattcaggaaagagactctaagctgactaaaaaatggttccagaggctattc
gaaggatgcgcgtacggtctgcagctgaacggaaatgaagcaattcacgcgactttgttg
gtatatcggcagctgctttctctgcaagggagccacctgcaagaacaatttgatgaaatg
tatgagatgacaatgcggtataaggaccacaagtacaacgttatacgcaaggaaatttac
gcaatactgccgcttttagcttctgcagatcctcaattgttcactgacaagtacctggat
cacgtaatgattcattacctcacgcttttgaaaaatatgcatgcttcccctacaaacaat
tcggaccgggctgcaatatcagtctcaataggcgacatcgcacaacaggttggctctaat
atagccccatacatggactcgattttagataacgtgagggacggtttaatgactaagttc
aagctacgcaaggaatttgaaaaagagctgttctactgcgtcgcaaagctagcttgcgca
gttgggccagttctagcaaaatacttgaaccgtgaccttctcgatctgatgctggcatgc
cccttgtctgaccatatgcaaacaacattctccacaattattgagaaaattccagcttta
tgccccacgatcaacgaaaaggtcttggacatgatctgtctcgcgttgtctggcgaaaag
ttcagccctcctggtgcgcctgtacccttaaaaccactctcaccggagaaggctagacat
taccgggatcacttgatattcaaaaagacaggtgagctgaatgacgacagtttggatgtc
cactatttgaaccaagctttgacaatgctgcacaagataaattatagatattctcttgtg
gaactcgtaaggttaatcacgatatcgtacatcgaacacgagaacccgcaagttagaaaa
ctcgcagccctgacatcatgcgatttgtttgtgaaagattcaatctgcaaacagacttcg
ctgcgagctctcaacacagtttccgaggttctgagtaagctgctaactgtcgccataaca
gatccagttgttgaaattaggtttgaagttttgagacatcttgacgccagttttgatcct
cagctttcacaaccagacaatgttcggttgctatttatggccctgaatgatgaagtcttt
gcaatccagatggaggcgatgaaaataattggtcgtctctcgatagtcaaccctgcttac
gttataccatcgttaaggaaaacgttgctacagcttttgagccagctgagtcattctaat
atgtctaggaagaaagaagaaagtgcttcccttattagcaatttgataagctccagcaag
gacatcacaaaaccgtacattgagccaatccttgatgttttgttacccaaatgcaaagac
gcatcctcggccgtagcctccactgccctgagggctgttggagaacttgccgtcgtcgga
ggggaagagatgactcttttcttggaccaattgatgccgctcataattgacacctttcaa
gatcaatcaaactctttcaaacgtgatgcggctttaaaaacgcttggtcagctgtcagcg
tcttcgggttatgttatcaagccgttgctggactaccctcagctattgggcgttttgata
agcattctaaaatcagaaagttcacaaaatatcagacgcgagacagtccgcttaatcggg
attttaggagcgcttgatccatataagcagagagaagttgaaagaacatcgaacacgaac
ataacagcagagcaaaatgcgccgcgtatcgacgttgctcttctcatgcaaggcatgtcg
ccttccaacgacgaatattatcctacagtggtaatagcaactctaatgaaaatcctcaaa
gacccctcactgtcttctcatcacacatctgccatccaagcaataatgcacattttccag
accttgggcgtgcgctgcgtctcctttttgaagcagattatccctgggataattaacgtc
atgcggacgtgcccaccatccttgttggaattctactttcagcagctgggaatcctaatt
tcgattgtgaatcagcacataaggccgttcgtggccgagatttttgaagtggtgaaggag
ttctttcctatcgtcaaactgcagataactataatatctgtgattgagtcattctccaag
gctttgaatggcgaattcaagctgtttcttcctactactcttaccctgtttttggacgta
cttgagaaagacaagtccagtaggaaatctgtctctgtgagaattttgaagtctcttgtt
gtcttcgattcaaatctcgaagagttctctcacctggttattccaacaatagttaggatc
gcagagtatggtgccggttcgttgaatagagtcgcaataataacccttggaaggctcgca
aaaaccgttaacctttcagaaatgtcatcccgaattgtacaagctctcatacgtgtgcta
aattctgggaatgcggacctgataaaggcgactatgaatactttgagcttactgcttctt
cagatggatgttgattttgcagtttttattccaataattaacaagactttagtcaaaaat
caaattcagcatacagtgtatgatcagctggttaacaagcttttgaaccatgaagcactg
ccaacaaacataatcatagatcgagactttgacgttgtcagtaaagaaatcgcagaaatt
gaattgccctccaaaaagctgcctgttaatcagctggtattgaaaaatgcttgggactgt
agtcaacaaagaactaaagaagactggcaagaatggattcgccgtttggctgttcaactc
cttaaggagtcgccttcgcatgcgctaagagcatgctcaggtttggcaggaatatattac
cccttagctcgcgagctcttcaacgcttcttttgcaagttgttggactgagctatacact
cagtatcaagaagatctggtgtcgtctctctgcatggcgctttcttctcccaacaaccct
cctgaaatccatcagactcttttgaaccttgtggaatttatggaacatgatgataagtcc
cttccaattcctgtcccaactttgggcgaatatgcccaaaagtgccatgcatacgcaaag
tccttgcattacaaggagctggccttcattcaggaacctagcacttcaactattgagtca
ttgataagcataaacaatcagttgcatcaaacagacgccgccattggcattttgaaacac
gctcaacagcatcacgaccttcagttgaaagaaacatggtacgaaaaacttcaaagatgg
gaagacgcactgaacgcttacaatcaacgtgaactcgctggcgaggattctatcgaggtt
agaatgggtaaaatgagatctttacacgccctgggtgagtgggaccgtttatcagagatg
gccgcagaaaaatggagtacatcgagcatggaagttaagaggatcattgcccctcttgct
gcaggtgccgactggggccttggtcagtgggatagaattggtcaatatattgatgctatg
aaaagtcactcaccagacaaagcatttttcgatgcaattctgtgctctcatcggaacaat
tttgatgaagccgaaaagcacatatttgaagctcgagacctattggtcaccgaaatatcg
gcgttagtaaatgaaagctataacagagcttacagtgtaattgttcgagcgcaaatgata
tcagagctaggggaaattattgaatataaaaaactaccacctgcttctgaaaagcgtgcg
gctatcagaaagacgtggaacaaaagactactcggctgtcagaaaaatgttgatgtctgg
cagaggattttgcgagtgcgctcccttgtggtgaaacctaaacaggatatgcaagtctgg
atcaagtttgccaatttgtgcaggaagtcgggaagaatggggctggcccaaaaagccctc
aactccctcttggaagatggcggcgaccctgatcatcccaatactgcgagagccccccct
cccgttgtatacgcgcagttgaagtacatgtgggccaccggttctcaaaaagaagctttg
cggcaccttatcagcttcacgtcaagagttgcacacgatcttggtctcgatccaagcaac
atgatagcccagagcgtaccacaaaatagcacaattccggctcatcacatcgaggagtat
actaagcttcttgcacggtgcttcttaaagcaaggtgaatggagagtatcgcttcaaacc
aattggcgcatggaaaaccctgatgcaattttaggctcctatctgttggctacacacttt
gataacagatggtacaaggcatggcataattgggccctggcaaatttcgatgtcatatca
atatcatcaagaggaaatgacgacaaaatgctacaaaatggaacaggcgaattcggtatg
aatgacagcgctttacaagaacccgaaagctcattggaagtggaaaatgatggaaatacg
ctgaacaaaaccttatttcctcctgaactggttcaaaggcacgttgtgccggctatcaaa
ggattttttcattcaatccttctctcagagtcaaactctctacaagatacactaaggcta
ctgacattgtggttcaagtttggtggtatcccagaggcagcgcaggctatgcacgaaggt
tttaatctcatcaaaattgacaactggttagatgttgttcctcaattaatcacgcgtatt
caccaaccaaaccaaactgttagcatgtccttactttcgttactttctgacttaggtaaa
gcacatcctcaagcactggtctatccgctaacggtcgctatcaagtccgagtcggtctca
agacaaaaggcagctttatcaatcatagcaaaaatgaggatccatagttcgattttggtt
gaccatgcggaaattgtcagtcatgagctgattcgtgttgctgtgttgtggcacgagcta
tggtatgaaggtttggaagacgcaagcagacaattttttggtgagcacaatactgaaagg
atgttcgcaacacttgagcccttgcatgaaatgctaaagagaggaccggctactttgcgt
gaaatttcattccaaaactcttttggaagggacttgaatgacgcatatgagtgggtaatg
aactacaagcgcaataaggatatcacaaacctgaaccaagcttgggacatatattacaac
gtgttccgtagaatcagcagacaactcccccagttacaaaccttggaactgcaacacgtt
tctcccaaactgcttgccgctcatgacctcagtttagcggttccggggacgtaccaggct
ggaaagccgatagtgcgcatctcttactttgaacctgtattttatgtgatttcgtctaaa
caaagaccaagacgtttatctgtaaagggcagtgacggaaaagactaccagtacttattg
aaaggccatgaagacattcggcaagataatcttgttatgcagctctttggactggttaac
acactgctacaaaacgatcccgagtgtttccagaggcacctggatatccagagatactct
gccatcccactgtcaccaaaatctggtttattgggctgggttaataacagcgatacattc
cacgttttgatcagggaacaccgtgaggccaggaaaatacccctcaatatagagcacagg
ataatgctgcaaatggctccagattacgacaacctcacgcttctacagaagattgaagtc
ttcacgtatgcgctggataacactcgaggccaggacttatacaaagttttgtggttaaag
agtaggtcgtccgaatcttggctagaacgccgtactacctacacaagatcgcttgcagtg
atgtcaatggtcggatacattttgggactgggtgatcgacacccaagcaacttgatgttg
gaccgcatcactggaaaagttgtgcatatagactttggtgactgttttgaggctgctata
ctaagagaaaagtacccagaaaaggtccctttcaggctcaccaggatgctcacatacgca
atggaagttagtggcattgagggaagcttccgcataacttgcgaaaacgttatgcgggtt
ttaagagacaacaaggagtcgctaatggctattttagaagcgttcgcctatgatccattg
atcaactggggttttgatttacccacccagacaatcgcagagcaaacaggtactgaattg
cctttggcgaaccctagcgagctcttaagaaagggtacgatttcgattgaggaagccgca
aaaatggagattcggcaaaaggcggagatcaggaatgccagagctatgttggttctcaag
agaatcacggataagctaaccggaaacgatttccgcaggttccgtagtttggatgttcca
gatcaagttgaaaagctaattcagcaggcaacttctgttgaaaacctttgccaacactac
atcgggtggtgctcattctggtga

DBGET integrated database retrieval system