KEGG   Lachancea thermotolerans: KLTH0C03278gHelp
Entry
KLTH0C03278g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C03278p
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lth  Lachancea thermotolerans
Pathway
lth00052  Galactose metabolism
lth00500  Starch and sucrose metabolism
lth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KLTH0C03278g
   00500 Starch and sucrose metabolism
    KLTH0C03278g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KLTH0C03278g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 8291232
NCBI-ProteinID: XP_002552368
UniProt: C5DDR9
Position
C:285155..286954
Genome map
AA seq 599 aa AA seqDB search
MAFSSLKKSDSVGSTPHRKQNHPNKRKPFSKMQLLGSALGALVIAAGVTASQSNSRSRGK
NTDSQPQFNASSGTRPLVHLTPNKGWMNDPNGLFYDSEASIWHAYYQYNPNDNVWGLPLY
WGHATSEDLTVWEDHGAAIAPQNDESGAFSGSIIIDANNTSGFFNDSTKPAQRIVAFYTE
HNATTESQYAAYSLDGGFTFEQYEHNPVLDIGSDQFRDPKVFWHEESERWVMTLALSQEY
TIQIFTSENLKDWELQSNFSHHGILGYQYECPGLAKVRVERDIPLNVTSNGKTNLTTQDD
GAEYKWVMFLSINPGSPAGGSVNEYFIGDFDGKTFTPQDSAARIVDHGKDFYALQTFTNA
PNGDTIGIAWASNWDYCAFVPTEAWKSSMSIARNFTVRPYNPNPQSTELNLYSTPILNST
DLQTKRYLKKSSLEIGADEALKYNLGNDAQGLLEFTATWKVNGSSIPSVGDFADLSFWFT
GKEDDDEYLRLGYAVNAAGFFVDRGNTDVDFVNDNPFFNNRQTQNIETYKIGTDGLPIYK
VHGIIDRNIIELFFNDGSSTSTNLFFLSDGNYIGGVEITAGVEGVFTILDFEIKQLARK
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcgagtctcaagaaatctgattctgttggctcgactcctcataggaaacaa
aaccatcccaacaaacgcaaacccttttccaaaatgcaattgctcggttccgccctaggc
gcgctggtgatcgcagctggagttactgcttcgcaatctaacagcagatcccgtggtaag
aacactgactcgcagcctcagttcaatgcttcgtcgggtacacgcccgcttgtgcatctc
actcctaacaaggggtggatgaacgaccccaatggcctcttctatgacagcgaggcctcc
atctggcacgcgtactaccagtacaaccccaatgacaacgtgtgggggctgccattgtac
tggggtcacgctaccagtgaggacctgaccgtgtgggaggaccacggcgcggctatcgct
cctcagaacgacgaatccggtgccttctccggttcgatcatcatcgacgccaacaacacc
tcaggcttcttcaacgacagcaccaagcctgcccagagaatcgttgctttctacaccgag
cacaacgccacaaccgaatcccaatacgcggcttactcgctcgacggtggtttcaccttc
gagcaatacgagcataaccctgtgcttgacattgggtctgaccaattccgtgaccctaag
gtcttctggcacgaagagtcagagcgttgggtcatgactctcgcgctttctcaggaatac
accatccagattttcacttcagagaacctgaaggactgggagctacagtctaacttctca
caccacggaattcttggttaccaatacgaatgtcccgggctcgctaaagtccgcgttgag
cgcgatattcctctgaatgtcacttccaacggaaagaccaacttgactacccaggacgac
ggcgctgaatacaagtgggtcatgttcctgagtatcaaccctggctccccagcaggtggc
tccgtcaacgagtactttattggtgacttcgacggtaagactttcactccccaggacagt
gctgcccgcattgtggaccacggaaaggacttctacgctctgcagacatttaccaatgcg
ccaaacggcgacactatcggtattgcctgggcctctaactgggactactgtgcctttgtt
ccaactgaggcgtggaagagctctatgtcgattgcccgtaacttcaccgtccgcccttac
aaccctaacccacagagcaccgagctcaatctatacagcaccccaattttgaactctacc
gatttgcaaaccaagcgttacttgaagaagtcttccctggagatcggtgcggatgaggcc
ctcaagtacaacctcggaaacgacgcccagggtcttctagaattcactgccacttggaag
gtcaacggctctagcatcccatccgtcggcgactttgctgatctctccttctggtttacc
ggcaaagaagacgacgatgagtacctgagattaggatatgctgtcaatgctgctggcttt
ttcgtcgacagaggtaacaccgacgttgacttcgtgaatgacaacccattcttcaacaac
agacagacccagaacatcgagacctacaagattggaaccgatggattgccaatctacaag
gtccacggtatcattgacagaaacatcatcgagttgttcttcaatgacggttcatcaacc
tccaccaacttgttcttcctatctgacggaaactacattggcggtgttgagattaccgcg
ggcgtcgaaggcgttttcacaattctagatttcgagatcaagcaattggctagaaaatga

DBGET integrated database retrieval system