KEGG   Lachancea thermotolerans: KLTH0C03366gHelp
Entry
KLTH0C03366g      CDS       T01117                                 

Definition
KLTH0C03366p
Orthology
K08738  
cytochrome c
Organism
lth  Lachancea thermotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    KLTH0C03366g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(293119..293451)
Genome map
AA seq 110 aa AA seqDB search
MPAPYKKGSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFGRNSGQAEGYSYTDANI
KKNVQWSEQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLITYMVKACK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacaagaaaggttccgagaagaagggtgctaccctgttcaagaccaga
tgtctacagtgccacaccgtcgagaagggcggaccacacaaggtcggtcctaacttgcac
ggtgtctttggccgtaactccggccaggctgagggctactcctacaccgacgctaacatc
aagaagaatgtccagtggtccgagcagaccatgtctgactacttggaaaacccaaagaag
tacatcccaggtaccaagatggccttcggtggtttgaagaaggagaaggacagaaacgac
ctgatcacctacatggttaaggcctgcaaataa

DBGET integrated database retrieval system