KEGG   Lachancea thermotolerans: KLTH0C05104gHelp
Entry
KLTH0C05104g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C05104p
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00051  Fructose and mannose metabolism
lth00562  Inositol phosphate metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
lth01230  Biosynthesis of amino acids
Module
lth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lth_M00002  Glycolysis, core module involving three-carbon compounds
lth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0C05104g
   00051 Fructose and mannose metabolism
    KLTH0C05104g
   00562 Inositol phosphate metabolism
    KLTH0C05104g
Enzymes [BR:lth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KLTH0C05104g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KLTH0C05104g
  Exosomal proteins of bladder cancer cells
   KLTH0C05104g
  Exosomal proteins of melanoma cells
   KLTH0C05104g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8291314
NCBI-ProteinID: XP_002552447
UniProt: C5DDZ8
Position
C:complement(445672..446418)
Genome map
AA seq 248 aa AA seqDB search
MARTFFVGGNFKLNGNKQSIKEIVERINKASIPQNVEVVLCPPAPYLDYAAGLVSKPQVS
VGAQNAYYKAAGAFTGENSVEQIKDVGAKWVIIGHSERRTLFKETDEEVAEKTKFALDQG
LGVILCIGETLEEKKAGVTLKVVETQLNAVIAQVKDWSNVVVAYEPVWAIGTGLAATPED
AQDIHASIRKYLSEKLGADVAEKTRILYGGSANGSNAVTFKDKKDVDGFLVGGASLKPEF
VDIINSRN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggccagaactttctttgtcggtggtaacttcaagctaaatggtaacaagcaatccatt
aaggagattgttgagagaatcaacaaggcttctatcccacaaaatgttgaggtcgtcttg
tgcccaccagccccatacttggactacgctgctggcttggtgtccaagcctcaggtctct
gtcggtgcccagaacgcctactacaaggctgctggtgccttcaccggtgagaactctgtt
gagcagatcaaggacgttggtgccaagtgggtcatcatcggtcactccgagagaagaacc
ttgttcaaggagaccgacgaggaggtcgctgagaagaccaagttcgctttggaccaaggt
ctaggtgtcatcttgtgtatcggtgagaccttggaggagaagaaggccggtgtcaccttg
aaggtcgtcgagacccaattgaacgccgtcatcgcccaggtcaaggactggtccaacgtc
gtcgttgcctacgagccagtgtgggctatcggtaccggtttggccgctaccccagaggac
gctcaagacatccacgccagcatcagaaaatacttgtctgagaaattgggcgctgacgtc
gctgagaagaccagaatcttgtacggtggttccgccaacggctcgaacgctgttaccttc
aaggacaagaaggacgtcgacggtttcctcgttggtggtgcttctttgaagccagagttc
gtcgacatcatcaactccagaaactaa

DBGET integrated database retrieval system