KEGG   Lachancea thermotolerans: KLTH0C06358gHelp
Entry
KLTH0C06358g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C06358p
  KO
K14298  
mRNA export factor
Organism
lth  Lachancea thermotolerans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLTH0C06358g
Messenger RNA biogenesis [BR:lth03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     KLTH0C06358g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:556638..557741
Genome map
AA seq 367 aa AA seqDB search
MSAFWRGNGSSGVGSSVMSAEKDLANDIVINNPAEDSISDIAFSPQQDFLFSVSSWDKKV
RVWDINGGTAQGRAEYQHQAPVLATRWSGDGTKIASGGCDNAVMVFDVGSGQAQQVGAHD
AAVKALRFVQCGPTNAECLVTGSWDKTVKYWDLRQPQPISTLMMPERVYCMDSKQKLLVV
GTAERHIVVIDLNNPTSIFKTTTSPLKWQTRSVACYIEGNGFAVGSIEGRCAIQYVDDQE
QRKSGFSFKCHRVQQQSTGAAGGRSSTESQVYPVNSIVFHPVYGTFATAGGDGSFHFWDK
NLRHRLKGFPSLKASIPVCNFNRNGSIFAYALSYDWSQGLMGNRPDYPNVVRLHAVTDEE
VKEKKKR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcattttggcgtggcaatggaagtagtggggtgggatcttctgtcatgtccgca
gaaaaggatctggccaatgacattgtaataaacaaccctgccgaggactctatatcggac
attgcgttctcgccacaacaagattttttgtttagcgtcagttcctgggacaagaaggtt
cgcgtttgggacatcaatggcgggacggcgcaaggaagagcagaatatcaacaccaagcg
cccgtgttggccacgaggtggtctggggatggaacaaaaatcgcttctggcggatgcgac
aatgccgtcatggtgtttgacgtaggctcagggcaggcacagcaggtcggggcgcacgat
gcggcggttaaggcgctgaggttcgtgcagtgtgggcctaccaacgctgagtgtctcgtc
acggggtcttgggacaagaccgtgaaatattgggacttgcgccagccgcagccgatttct
actctcatgatgcctgagcgggtgtactgcatggattccaagcagaagctgcttgtcgtt
ggtacagcagagcgccacattgtcgtgatagatcttaacaacccaacctcgattttcaag
accaccacgtcgccgcttaagtggcagacccgttccgtggcctgttacatcgagggtaac
gggtttgcggtggggtctattgagggcaggtgcgccattcaatatgtggacgatcaagaa
cagcggaagtccgggttctcgttcaagtgccatcgtgtgcagcaacaaagcacaggcgcc
gcaggcgggcgaagcagcacggagtctcaggtctatccagtcaatagcatcgtgttccat
ccggtctatggcacgtttgcgactgctggcggcgacggctccttccacttctgggacaaa
aatctcagacatagactaaagggcttcccctcgctcaaagcctcgattcctgtgtgcaac
ttcaaccggaacggctccatatttgcctatgctcttagctacgactggagccaagggctc
atgggaaaccgtccggactatcctaacgtcgtgagacttcacgccgtgacagatgaagaa
gttaaagagaagaagaagaggtga

DBGET integrated database retrieval system