KEGG   Lachancea thermotolerans: KLTH0C06732gHelp
Entry
KLTH0C06732g      CDS       T01117                                 

Definition
KLTH0C06732p
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLTH0C06732g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0C06732g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(584097..586241)
Genome map
AA seq 714 aa AA seqDB search
MSLRKWLTRSDKPSRHKPATQGLHGEIDSAAKDTQAGGAKGDGAELSLGGKILSMITPSD
GNSSSSSGPDGVTENGYPSGNRETGSHIHGSQDASDPVSEKAYHSSSAISDFEDLESEYD
YFPLIKPSVTPLLPYGDGSNKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEFPERPSS
LPRRRKSEMPGIKPRIFDDTSFTHSNNGSENAKKNSSSSGSAGSLGKEPSRKTSASSLKP
GMSARAQRLHNASVVHGTVMASDAITEKLHEGFTRIVVGRVNGKSQKRSVQRTPPSNSAS
SSSSSVMESSPPNISLASSTRPEETSSEERKSSALIRGPVLNVDHSLIDYLPQGEKPSLY
TALKDLYESITENKFLTGVVSPIQFVETLKRENILFSSTMHQDAHEFLNFLLNDISDYIN
AHSKNNIQAHETTNPMDDNHLNFVDRLFKGTLTNRTKCLTCDNMTYRNEPFLDFAIEVQD
DGETDIQTTLADYHQKELLNGANKFYCDECCGLQEAERVVGLKQLPFYLALHMKRFKYSE
EQNCNVKLFNRIRYPLDLKVCSTFDASVCKQYELVGLVVHMGGGPHHGHYVSLCKNERFG
WLLFDDETVETVNESTVLKFVGNSDDLTTAYLLFYREKTAGATSGNDKSQEYAECVDELI
KLDEKIRVGSESGKNDQNTTLEEVPEERRGERKLSSKGLKRRSRIFSFKRSPKD
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgagaaagtggcttacacgcagcgacaagccgagcaggcacaagccggcaaca
cagggtttgcatggcgagatagattcggccgcgaaagatacacaggctggtggagcgaag
ggtgatggcgcagaattatccctgggaggcaaaattttgagcatgataacgccgtcggac
ggcaatagctcgtcttcctcgggccccgacggtgtcacagaaaatggataccccagcggc
aaccgcgagaccggcagccatattcacggcagccaggatgctagcgaccctgtgtctgag
aaggcgtaccattcttcgtccgcgatcagcgattttgaggacctggagtctgaatacgac
tactttcccctgatcaagccttcagtgacgcctctcttgccatatggagatggctcaaac
aaggtttttggctacgaaaactttggaaacacctgctactgcaattcggtgctgcaagtc
atttacaacctaccagagctccgcgtaaacctgttagaattcccagaaaggccgtcttcc
ctgcctcggaggcgaaagtctgagatgcctggcatcaagcctcgaattttcgacgatacc
agctttacccattcgaataacgggagcgagaatgccaagaaaaactccagttccagcgga
agcgcaggctctctcggaaaagagccttccaggaaaacctctgcatcctctctgaaacct
gggatgtcagcacgagctcagcgcttgcataacgcctctgttgttcatggcacggtgatg
gcctctgatgctataacggaaaaactgcatgaaggcttcacgcgaatcgttgttgggcgc
gtgaacgggaaaagccaaaagaggtctgtacaaaggacgccgccatcgaactcggcatca
tcgtcttcgagctctgtcatggagtcatcccctccaaatatctcgctagcgtcttctact
agacccgaggaaacgtcaagtgaagaacggaaaagttctgcccttataagaggcccggtt
ttgaatgttgatcattctctgatcgactacctgccgcagggagagaaacctagcttatac
actgcattgaaggacctttatgaaagcattactgagaacaagtttttaacaggcgtcgtg
tctccaatacaatttgtcgagactttaaaacgagagaatattctctttagcagtaccatg
catcaagatgcccatgaatttttgaactttttgttgaatgatataagtgactacatcaac
gcacattccaaaaacaacatccaagcccatgaaacaacaaaccctatggatgacaaccac
ttgaattttgttgaccgactcttcaaaggcactttgacaaatagaaccaagtgcttgaca
tgtgataacatgacgtaccgtaatgaaccattcttggatttcgcgatagaagttcaagat
gacggcgaaaccgacattcagacaactttggctgactatcaccagaaagaactacttaac
ggtgccaacaagttttattgtgacgagtgctgtggcctacaggaggccgagagggttgtt
ggtctaaaacaactaccattttacctcgctttgcatatgaagaggttcaaatactcagaa
gaacaaaactgcaatgttaagctgttcaatagaatacgatacccgctcgatcttaaagtt
tgctctacctttgatgcatctgtctgcaaacagtacgagctggtaggcctcgttgttcac
atgggcgggggccctcatcatggccattacgtctctctctgcaaaaatgaaaggtttggg
tggcttcttttcgacgacgaaacagttgagacagtgaatgaatcaactgtgttgaagttt
gttggaaactccgacgacctcacaaccgcctacctgctgttttatagagagaagaccgcc
ggggccactagtggtaatgacaagtcgcaggaatatgccgaatgcgttgacgaattgata
aaacttgacgagaaaatacgggttggctcagaaagcggcaaaaacgatcaaaatacaacc
cttgaggaggtgcccgaggaacgccggggagagagaaagttatcgagcaaagggttaaag
aggcgttcaagaatttttagcttcaaaaggtcgccgaaggactaa

DBGET integrated database retrieval system