KEGG   Lachancea thermotolerans: KLTH0C07326gHelp
Entry
KLTH0C07326g      CDS       T01117                                 

Definition
KLTH0C07326p
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLTH0C07326g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0C07326g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KLTH0C07326g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:633748..636036
Genome map
AA seq 762 aa AA seqDB search
MSELEEFGLLQIPSVIHKDDCGYCFESMYNDDQMASHALNVCLTCFQSFCDTHIPVHQSV
AKNDFNDKHDFLLKVSKIRKPEQKQPIEKKLKLEITEKSEDDTYESLWWLTKGAVIIADY
RTQGLNSSVTTKVTEILNARSSNFQNMTQAWQLEVKPCVHVENLEVPNDNPQTVANRCTD
CKLGSNLWMCLHCGNVGCGRQQVGIEGHSHALKHFESNPGHPLAVKLGSLSNSAADIYCY
SCDDEVQFADTKKWIQLLLYWGIDIQSRVAQEKTLLELQVEQNMNWDFQMVDAEGHELRH
LEGSKKYGYGLQNLGNSCYLNSVLQVLLNGDLSRWSLEGLGDFPGDVLYVSSNLRCQLIK
MRNALKNEPEKYPHGVKPTTFKHCIGGTHEEFSSGRQQDALEFFSYFVDLLDKKVFEKSS
SNPNDLMKFSLQDRIECTKCHGVKYTSQVSDYLQVLLSDSEEPQDLLANLAQNFQGDEVE
FKCPTCNETTKANKSCGFRTFPEILVASCSRIKLVNWVPVKTSQEVLVPGTQAADTAILE
LGQFKSNGFDPDNETLLEKGEPAGFEPKANCIIQLTEMGFSENAAVRALYHSGNSSAEVA
ANWLFQHMDDADLNDPFIVPSAPSKAAEVNPQALENMAAMGLNPELCRKALIINQGNVSA
SVEWVFNNLDYCDSSIQESTVDEDDKEYGITDKDKANYRLKAVVCHKGASVHSGHYVAFI
KKQVENEVKWVLYNDEKIVVADSPTNIEEIKKNGYIYFFDRS
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcttgaagagtttggcttattgcagatcccttctgttatccacaaagatgac
tgtggttattgctttgaaagcatgtacaacgatgatcagatggcatcgcacgccttaaat
gtgtgcttaacgtgcttccagagcttctgcgatacgcatatacctgttcaccagtctgta
gccaaaaacgatttcaatgacaagcacgacttcctactgaaggtaagcaaaatcaggaaa
ccagaacagaagcagcccattgagaagaaattgaagctagaaattacagaaaagtctgaa
gatgatacctatgaatcgctttggtggctcaccaaaggtgcagtaataatcgcggactat
cgaactcagggccttaattcttcggtaacaacaaaagtcacagagatactgaatgctcga
tccagcaactttcaaaatatgacccaggcttggcaactagaagtcaaaccctgtgttcat
gttgagaaccttgaggtcccaaatgataatcctcaaaccgtcgccaacaggtgcacagat
tgtaagttaggaagtaatctttggatgtgtcttcactgcggcaacgtcggatgcggcaga
cagcaggtgggcattgaaggacattctcacgcgctcaaacactttgaaagtaacccagga
catccattggcagtaaaattgggttctttgagtaactcagcagccgacatttattgctac
tcctgtgatgatgaggtccaattcgccgacacaaaaaagtggattcaactacttttgtat
tggggcatcgacatccagagccgggtggctcaagaaaaaaccttgcttgagctgcaggtt
gagcaaaatatgaactgggactttcaaatggttgatgctgaaggccatgagctgcgccac
ttagagggatcgaagaaatatgggtatggtctgcaaaatttggggaattcgtgttatttg
aattcagttctgcaggtccttcttaatggcgatttatctaggtggtcgctggaaggcctt
ggcgactttcctggtgatgttctctatgtttccagtaacctgagatgtcaactgattaaa
atgagaaatgctttgaaaaacgagcctgagaaatatccgcacggtgttaaacccacaact
tttaagcactgtattggtgggacacatgaagagttcagctctgggaggcaacaggatgcg
cttgagttcttttcttattttgtcgatctactagacaaaaaggtgttcgagaaatcttca
tcgaatccgaatgatctcatgaaattttcacttcaggataggattgagtgtaccaagtgc
catggtgtgaagtacacaagccaggtttctgactacttgcaagttctcctttcagattcc
gaggagcctcaggatttactggccaatcttgcacagaactttcagggcgatgaggttgaa
ttcaaatgtcccacctgcaatgagaccacgaaagccaataaatcttgcgggttccgcact
ttcccagagattttagtggcgagctgtagtagaataaagcttgtgaactgggttcctgtg
aaaacatctcaagaagttttagtgccaggaacacaagctgcagacaccgcgatattggaa
cttggccaattcaagtccaatggattcgatccagataatgagacactccttgaaaagggc
gaacccgctgggtttgagcctaaagcgaactgcattattcaacttacggagatggggttt
tcggaaaatgctgcagtcagagctttgtatcacagcggtaacagcagcgcagaagttgct
gccaactggcttttccaacacatggacgatgcagacctgaatgatccttttattgtacca
agtgcgccctcaaaagcagctgaggttaacccacaagcgcttgagaacatggctgctatg
ggcctgaacccggaactgtgccggaaagctctcatcattaaccaaggcaacgttagcgct
agtgtcgaatgggttttcaacaaccttgattactgcgacagtagcattcaagagtcgaca
gtagatgaggatgacaaagaatatgggattactgacaaagacaaagccaattacagactt
aaggcagtggtctgccataagggagcgtcggttcattccggacactatgtggcatttatc
aaaaaacaagtcgaaaacgaagtcaaatgggttctttataacgacgaaaagatcgttgtt
gcggatagccctacaaatatcgaagaaatcaagaagaacggctacatttacttcttcgat
cgctcttag

DBGET integrated database retrieval system