KEGG   Lachancea thermotolerans: KLTH0C07502gHelp
Entry
KLTH0C07502g      CDS       T01117                                 

Definition
KLTH0C07502p
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lth  Lachancea thermotolerans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KLTH0C07502g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KLTH0C07502g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(647606..648883)
Genome map
AA seq 425 aa AA seqDB search
MKVTWVGCLTSLAGSSLAYVISDQGHFSNHRTDLLDQVFGEVLASHDGSGAAEVRQRSFN
LDEDEDPEFKAMCGFYQEHPVEFPDDDLSNDLELFAGIVSFAHVPIERCFGSRTDGKSPL
YDIAIVGAPFDTSVSYRPGARFGPNAVRQGSRRLGGGILPVRGFPGSKLRKLDPYNAGYK
IVDCGDVPMTPYDNRIALNQLYRGQRAIYNKTTLKSDLKAPKVITLGGDHTVTLMALKAA
SEHNGPLAVVHFDSHIDTWDPKVLGGGITKTQSINHGTFLHFAHERGYIARDKSMHVGIR
APFIAPTDDKHDRECGFQKIVARDFDILGFQEIVSQIKQRVGDLPVYITVDIDVLDLSVA
PGTGTPEPGGLTSRELLTVLDGLEGLNVVGADVVEVSPAFDTNGDITSIVAAQVIDSILG
LMTVG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacttgggtgggatgtcttaccagccttgctggctcgtccctcgcgtatgtg
atctctgaccaggggcatttctccaaccacagaaccgatcttttggatcaagtcttcggc
gaagtcctagcaagccacgatggttcaggggcggcggaagtgcgccaacgtagcttcaat
ctcgatgaagacgaggaccccgaatttaaggccatgtgcggattctaccaagagcatcct
gttgagtttccagatgatgatttgagcaatgatttggaacttttcgcaggcattgttagc
tttgcgcatgttccaattgagcggtgtttcggatctcgcacggacggcaaatcacctctt
tatgacatcgcaattgttggtgctccctttgacacctcggtgtcttaccggcccggagct
aggtttggcccaaatgcagtaagacaaggctctcgcagactaggcggtggaatactgcct
gttagaggatttcccggatccaaactgagaaagcttgacccttacaatgcaggctataag
attgtggactgcggggatgtgcctatgacgccttatgataacagaatcgcgctaaatcag
ttgtatagagggcaaagggccatctacaacaagactacgctgaagagtgacctaaaagct
cctaaagtgataacgcttggcggggaccacactgtcacacttatggcactgaaggcagct
tctgagcataatgggcctttggcggtagtccattttgattctcacattgacacctgggac
cctaaggttctgggcggcggaattacaaaaactcaaagcatcaatcatgggacattcctg
catttcgctcacgagcgaggctacattgctcgtgacaagtccatgcatgttggtataaga
gcacctttcattgcgcccacagatgacaagcacgatagggagtgcggattccaaaaaatt
gtggcccgcgactttgacattctaggtttccaagagattgtaagccagatcaagcagcgc
gtcggggacctacctgtttacataactgttgacattgacgtgcttgacctttctgtggcg
ccaggaactggaacaccagagcctggtggactcacatcaagagaattgctcaccgttctt
gatggcttggaaggtcttaacgtcgttggagctgacgttgtcgaagttagccccgcgttc
gatacaaacggtgacattacgtccatcgtagcagcccaagttatcgactctatactaggc
ctgatgactgtgggttga

DBGET integrated database retrieval system