KEGG   Lachancea thermotolerans: KLTH0C08822gHelp
Entry
KLTH0C08822g      CDS       T01117                                 

Definition
KLTH0C08822p
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
lth  Lachancea thermotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:lth00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(739352..740434)
Genome map
AA seq 360 aa AA seqDB search
MPFEKELFVATQAVRKAALLTKRIQAQVIADRKSTITKTDSSPVTVGDYSAQAIIINAIK
ANFPEDEIVGEEESKGLNDEFVGQILREIEATEAPFKELFGEYDSVRAGMQFRSREYPLT
SLADVRRVIDLGSSEGGRKTRFWCLDPIDGTKGFLRGEQYAVCLALVVGGVVQLGCIACP
NLELANYGGKDSDPEAAHRLGYVFRAVRGHGAFFAPTAVDFSWHPLPVRSLSSTRDMVSL
EGVEKGHSAHSAQDAVKEELGISRALHLDSQVKYCLLALGLGDVYLRLPISLSYREKIWD
HAAGNALVAETGGQHTDSIEGVPLDFGNGRTLATKGVIASSGTKLVHQMIVDSSSKAINK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccattcgagaaagagctcttcgttgctacacaagcggtgcgcaaagccgcactacta
actaagcggattcaggcgcaagtgatcgcagacaggaaatcgactatcaccaagaccgac
agctcgcctgtgacagtaggggactactcggcacaagccatcatcatcaatgcgatcaag
gccaatttccccgaagatgagatcgtgggcgaagaagaatccaagggcctgaacgacgag
ttcgtcgggcaaattttgcgtgagatcgaagcaacagaagctcctttcaaggagctgttc
ggcgaatacgactcggtacgtgcaggaatgcaattccggagccgcgagtatccgctcacg
tcgctggcagacgtacgccgcgtgatcgatctgggcagcagcgaaggtggtcgtaaaacc
cgtttttggtgcctggaccctatcgacggcacaaagggtttcttgcgtggagagcagtat
gctgtatgtcttgcgcttgtcgtgggcggggtcgtgcagctcggctgcatcgcatgcccc
aacctggagctcgccaactatggtgggaaggattccgatccagaagccgcgcaccgctta
ggatatgttttccgcgctgtacgtggacacggggccttcttcgcgccaacagctgtggac
ttttcctggcatccgctgccagttcggtcgctttcctcaacgcgcgacatggtttcactc
gaaggcgtcgaaaagggccactccgctcactctgctcaggacgccgtaaaagaggagctg
ggaatctctcgcgcgctgcaccttgactctcaagtgaagtactgcttgctcgcactcggc
cttggcgacgtctacctgcgccttcctatcagcttgtcttatcgcgaaaagatttgggat
cacgctgctggcaacgctctagtcgccgaaactggcggccagcatacagacagcatcgaa
ggcgttccgctggatttcggcaacggcagaactctggctactaagggtgtcatcgcctcc
agtggcaccaagcttgtccatcagatgatcgtcgactcatcgtcaaaagcgatcaataag
tag

DBGET integrated database retrieval system