KEGG   Lachancea thermotolerans: KLTH0C08822gHelp
Entry
KLTH0C08822g      CDS       T01117                                 

Definition
KLTH0C08822p
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
lth  Lachancea thermotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    KLTH0C08822g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     KLTH0C08822g
Transfer RNA biogenesis [BR:lth03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    KLTH0C08822g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(739352..740434)
Genome map
AA seq 360 aa AA seqDB search
MPFEKELFVATQAVRKAALLTKRIQAQVIADRKSTITKTDSSPVTVGDYSAQAIIINAIK
ANFPEDEIVGEEESKGLNDEFVGQILREIEATEAPFKELFGEYDSVRAGMQFRSREYPLT
SLADVRRVIDLGSSEGGRKTRFWCLDPIDGTKGFLRGEQYAVCLALVVGGVVQLGCIACP
NLELANYGGKDSDPEAAHRLGYVFRAVRGHGAFFAPTAVDFSWHPLPVRSLSSTRDMVSL
EGVEKGHSAHSAQDAVKEELGISRALHLDSQVKYCLLALGLGDVYLRLPISLSYREKIWD
HAAGNALVAETGGQHTDSIEGVPLDFGNGRTLATKGVIASSGTKLVHQMIVDSSSKAINK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccattcgagaaagagctcttcgttgctacacaagcggtgcgcaaagccgcactacta
actaagcggattcaggcgcaagtgatcgcagacaggaaatcgactatcaccaagaccgac
agctcgcctgtgacagtaggggactactcggcacaagccatcatcatcaatgcgatcaag
gccaatttccccgaagatgagatcgtgggcgaagaagaatccaagggcctgaacgacgag
ttcgtcgggcaaattttgcgtgagatcgaagcaacagaagctcctttcaaggagctgttc
ggcgaatacgactcggtacgtgcaggaatgcaattccggagccgcgagtatccgctcacg
tcgctggcagacgtacgccgcgtgatcgatctgggcagcagcgaaggtggtcgtaaaacc
cgtttttggtgcctggaccctatcgacggcacaaagggtttcttgcgtggagagcagtat
gctgtatgtcttgcgcttgtcgtgggcggggtcgtgcagctcggctgcatcgcatgcccc
aacctggagctcgccaactatggtgggaaggattccgatccagaagccgcgcaccgctta
ggatatgttttccgcgctgtacgtggacacggggccttcttcgcgccaacagctgtggac
ttttcctggcatccgctgccagttcggtcgctttcctcaacgcgcgacatggtttcactc
gaaggcgtcgaaaagggccactccgctcactctgctcaggacgccgtaaaagaggagctg
ggaatctctcgcgcgctgcaccttgactctcaagtgaagtactgcttgctcgcactcggc
cttggcgacgtctacctgcgccttcctatcagcttgtcttatcgcgaaaagatttgggat
cacgctgctggcaacgctctagtcgccgaaactggcggccagcatacagacagcatcgaa
ggcgttccgctggatttcggcaacggcagaactctggctactaagggtgtcatcgcctcc
agtggcaccaagcttgtccatcagatgatcgtcgactcatcgtcaaaagcgatcaataag
tag

DBGET integrated database retrieval system