KEGG   Lachancea thermotolerans: KLTH0C10406gHelp
Entry
KLTH0C10406g      CDS       T01117                                 

Definition
KLTH0C10406p
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
lth  Lachancea thermotolerans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    KLTH0C10406g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     KLTH0C10406g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(862020..863681)
Genome map
AA seq 553 aa AA seqDB search
MKKLKSYMNNYGRAVLTDTGIMIKGQQSLPADAMEASDSSNANPFADNEDRETRNSFDTS
SLISCVTCLSESDSRADESSSGPLPTNTLIPYAKVLHAKEICAVSTELTPYRDEVGEQES
SNAGETILSTLVEVTYARPRRHDLVPKKQLLCVGALPSGGSIVEEIMSRSYKGTKRNKTI
LVIMNPHGGKGHAKKLYLSKVKPILAASNCTVETVETTYHGHATDLAKTVDADKFDIIAC
ASGDGIPHEVLNGLFQRPDRADAFNKLIITQLPCGSGNAMSVSCHGTTNPSHAALNILKA
PEIRIDLMCCSQPSYKDQPRLSFLSQTYGIIAESDVNTEFIRWMGPARFDLGVLLNILQR
KKYPCEVHVKYAAKTKNELREHYTYHKSKIGRGESQETLDASKQDISESAFELKYPLSDE
IPEGWETVDPTITNNLGIFYTGKMPYVAPDAKFFPAALPSDGTFDLIITDSRTSLSRMVP
ILLSSDKGHHVLQPEVIHSKITAFRLIPKLKHSVISVDGEKFPFEPLQVEILPGVCRTLS
YDGSYVETDFDSM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactgaagtcgtacatgaacaactatggaagggctgtgttgacggacacggga
atcatgatcaagggccaacagtccctccccgcggatgccatggaggccagcgatagctca
aacgccaacccatttgcagacaacgaagaccgtgaaactcgcaacagctttgacaccagc
tcgctcataagctgcgtgacatgcctgagcgagagcgattcgcgggcagatgagtctagt
agcggacccctgccgaccaacactttgattccctacgccaaggtactccacgccaaggag
atatgtgctgtcagcacggaacttacaccctacagggacgaggtcggcgagcaagaaagc
tcgaatgccggtgaaacaattttgtcaaccttggtcgaagtcacttatgcaaggccacgt
cgacacgacttggtccccaaaaagcagcttctttgtgtgggagccttgccctcgggcggg
agcatagtggaagagatcatgtcgcgaagctacaagggcacaaaacgcaacaagactatc
ctcgtaatcatgaacccacacggaggcaagggccacgccaaaaagctttatctctctaag
gtcaagcccatcttggccgctagcaactgcacggttgagactgtcgaaacaacataccac
ggccacgctacggatttagcgaaaaccgttgatgctgacaagtttgatatcattgcttgt
gcctccggggatggtattccgcacgaagttctgaacggtcttttccagaggcccgaccgc
gccgacgcttttaacaaattgataatcacacagctgccctgcggatcaggcaacgccatg
agcgtttcgtgccatggcactacaaatccttcacacgccgcgttgaacattttaaaggct
ccagagataagaatagacctgatgtgctgctcacaaccatcttataaggaccagccaagg
ctctcatttttgagtcaaacttacggcatcattgcagaatcagacgtgaatactgagttt
attagatggatgggtccggctaggtttgacttaggcgtccttctcaatattttgcagaga
aaaaagtatccctgtgaggtccatgtgaagtacgcggccaaaacaaagaacgaattgcgc
gaacactacacctatcacaaaagcaagatcgggagaggcgaaagccaggaaactttagat
gcctcgaagcaagatataagtgaatcagcctttgagttaaaatatcctttatctgacgag
attcccgagggctgggaaaccgttgacccaacaataacaaacaatcttgggatcttttac
acaggaaagatgccctatgttgctcccgacgctaagtttttcccagcagcgcttcccagc
gacggaacctttgatctcataatcacagactcgagaacatcgttgtctaggatggttccc
atcctgctgtcatcagataaagggcatcatgtattgcagcctgaagtaattcattcaaag
attacagcgttcaggttgattcccaaattaaaacacagcgttatatcagttgatggcgag
aaattcccattcgagcccctgcaggttgaaattctacccggcgtgtgtaggactttgtcc
tacgacggctcatacgtcgaaaccgattttgattccatgtag

DBGET integrated database retrieval system