KEGG   Lachancea thermotolerans: KLTH0C10670gHelp
Entry
KLTH0C10670g      CDS       T01117                                 

Definition
KLTH0C10670p
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
lth  Lachancea thermotolerans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KLTH0C10670g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KLTH0C10670g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:882520..884478
Genome map
AA seq 652 aa AA seqDB search
MLWLVPLFLLALRAVQAWSPTDSYAPGNVSCADDISLVREASGLSPNETAWLEKRDAYTK
QALREFLDGATANFSNSSLVDSLWSADKIPRVAMAFSGGGYRAMLSGAGMISAFDNRTNG
STEHGLGGLLQGATYLAGLSGGNWLVGSLAWNNWTSVQHVIDTRGKDDELWDISNSIVNP
GGINILSSASRWDQISDAVEAKQDAGFNTSLADVWGRALAYNFFPTLSKGGDGYTWSTLR
DADVFKNGEMPFPISVADGRYPGTQIVDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTN
ARNGTPVTKGQCVAGFDNTGFVIGTSSTLFNQFLLQLNTTSVSSFLKGIIGDFLKDLSED
YDDIAIYNPNPFRETEFVESNYTKGIVNSENLFLVDGGEDGENIPFVPLIQKERDVDVIF
ALDNSADTDEYWPAGLSLISTYERQFGAQGKDIAFPYVPDFDTFINEGLNQKPVFFGCDA
SNTTGLSYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRMKMFQNGFEAVTRNNLTDDSS
FRGCVACAVLRRKQESQNMTLPQECAKCFQDYCWNGKISNKTAKVSTIENYSGSISFITD
SASADAASSTAAASSSGTSTSKKNAAASLPSSNSLKWYVAFASLLGMAIGLM
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgctctggctagtgcccctctttttacttgcgctacgcgcggtgcaggcgtggtcgccc
acggactcgtacgctcctggcaacgtctcctgcgcggacgacatctcgctcgtgcgagag
gcgtccgggctctcgcccaacgagaccgcctggctcgagaagcgtgacgcgtacacaaaa
caggcgctgcgcgagttcctcgacggcgcgaccgccaacttctccaactcgtcgctcgtc
gacagcctgtggagcgcggacaagattccgcgcgttgcgatggcgttctcgggcggcggg
taccgcgccatgctcagcggcgcgggcatgatttccgcgttcgacaacagaaccaacggg
tccacggaacacgggctaggcgggctgctccagggcgccacgtacttggccgggctctcg
ggcggcaactggcttgttgggtctctggcatggaacaactggacgtctgtgcagcacgtg
atcgacacgcgcggcaaggacgacgagctgtgggacatcagcaactccatcgtcaacccg
ggcgggatcaacatcctgagcagcgcctcgcgctgggaccagatttccgatgccgtggag
gccaagcaggacgcgggcttcaacacctcgctggctgacgtttggggccgcgccctcgcg
tacaacttcttccccacgctctccaagggcggggacggctacacgtggtccacgctgcgc
gacgcagacgtcttcaagaacggtgagatgcccttccccatcagtgtggctgacgggcgg
tatccgggcacgcagatcgtcgacctgaactccacgctattcgagttcaatccgttcgag
atgggctcctgggacccttcgctgaacgcgttcacggacgtcaagtacctgggtaccaac
gccaggaacggcacccctgtgaccaagggccagtgtgtcgcgggctttgacaacaccggc
tttgtcattggcacttcctcgaccctgttcaaccagttcctgctgcagctgaacaccacc
agtgtgagctccttcttgaagggcattatcggcgatttcctgaaagacctttccgaggac
tacgatgacattgctatctacaaccccaaccctttcagggaaaccgagtttgtcgaaagc
aactacaccaagggcattgtcaactcagaaaacttgttcttggttgacggtggtgaggat
ggtgaaaacatccccttcgttcctctcatccagaaggagagagacgtggacgttattttc
gcgctcgacaacagtgccgacacagacgagtactggcccgctggcttgtcgctgatttct
acctacgagcgtcaattcggcgcacagggcaaggacattgcgttcccctacgtccccgac
tttgacaccttcatcaacgagggtctcaaccagaagcctgttttctttgggtgtgacgcc
tctaacaccactggtctctcctacaccccacccctcattgtctacatgccaaacaacagg
cagtcctacaattcaaacacgagtaccttcaagatgtcctacagttccagccaacgtatg
aagatgttccagaacggctttgaggctgtcactaggaacaaccttactgacgactcttct
ttcaggggctgtgttgcttgcgcagtcctaaggcggaagcaggagtctcaaaacatgacg
ctcccccaggagtgcgcaaagtgtttccaggactactgctggaatgggaaaatctccaac
aagaccgctaaagttagcactatagagaactacagtggatcgatttccttcattaccgac
tcggcatctgccgatgcagcttcttctacagcggcagcctcatcctcagggacctctact
agtaagaaaaacgctgctgcttccttgccctcttctaactctcttaaatggtacgttgcc
ttcgcaagcttgctgggcatggccattggtctcatgtaa

DBGET integrated database retrieval system