KEGG   Lachancea thermotolerans: KLTH0C11286gHelp
Entry
KLTH0C11286g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C11286p
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    KLTH0C11286g
Enzymes [BR:lth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KLTH0C11286g
DNA repair and recombination proteins [BR:lth03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     KLTH0C11286g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 8291592
NCBI-ProteinID: XP_002552706
UniProt: C5DEQ7
Position
C:926742..929597
Genome map
AA seq 951 aa AA seqDB search
MDGNGKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRV
EIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERR
LLNWKQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTT
GLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKI
LSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQ
LHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRK
IILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEI
LSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKP
EYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFC
NVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARS
VENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVS
PRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVK
HGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEP
KHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDL
DEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTART
AYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaatggtaaatgcccttcagaaacagacacatcaaagatctcagaaaatgag
ccacacaattttgcgccgtccccagattttagatggctttgtgaagaacttttccatagg
ttagatgcgatcaatgaacaccggcaggaacttggcaaggccgtcactgtgaaaagagtt
gagatcatcacatgttttattaagctatggaggactacagtaggagacgatttctttcct
gcgcttcggcttatgtttccttacagagacccaagagcataccacatcaaagactttaca
ttaataaaagctgtatgcaaggcactcaacctgtctagggattcactcacagaaaggcgc
ttgttgaactggaagcaatatgctggtcggggaactagcttatcgaaattttgtgtacag
gagatctcaaaaaggagaaaagaaccactgccagaacggcaactgacgattgatgggcta
aatgagaaacttgacgaactcgcgaaagaagcttccgggaaaaaggcgtggggcactacc
ggtctatcggagtctcattctttccaattttgcttaaaaaacttgtccttcttggagttg
cgatactttttcgatattgttctcaagaatagagtaataggggggctagaacacaaattt
ttagcttgctggcatcctgatgcgcaaatctaccttggtgttgttactgatctcaaaatt
ctctccaaaaagctctggaatccgtctgttaggttggataaaagggatctatcaatcaac
attggtcatgcgttcgctccacatctcgccaagaggcttcacgtttcatatgagcgtatc
tgttcaaagctcaagcatgactttatattagaggaaaagatggacggcgaaagaatccag
ttgcactatgtcaatggcggctcggtgctgaagttcttgagtaggcgaggcatagacttc
tcgcatttgtacggccaagaagttgcacgaggagtcatttcacaatatttgaaattaaag
agcgatgtccgcgattgcgtcttggacggagagatggttagctatgataaaaaaaggaag
attatcctccctttcggtattgtcaaatcagccgccgttgatgaattgataaattctgaa
gttgggaatgaaaatgacggctacaggccactttatatggtctttgacctcgtctatctt
aacggggtatcgctaacgaaagtaccactgcatataaggaaagaatatctcaaggaaatc
ctgagtcctgttccagatgttgttgaaattctgaagggcataagggcatgtgacgctaaa
gccattaagaacttcatgcaaagggcaatcgaaatgggctcggagggcgttattgtcaag
caggcatcttcaacttatgaagttggggctcgtaacgatcattgggtcaaaatcaagcca
gaatattttgaagacttgggcgagacaatggacttagtagtgatcggacgggacccaggt
aagaaagattctctcatgtgcggtctactagtttcagacagtgagcacatacttgagaac
tttggtccaatagagcatggcaaggaaggggatcccatcattaagtgtgtttcattctgc
aacgttgcgaatggagtatcagatgaagagttcaaggaaatcaatagaaaaactcgaggc
tcatgggttagctacaaggaaaaacctccacctttaagcttacttgaatttgggtcaaaa
ataccagttgaatggattgatcctaaaaactcagttgtcatagaagtcaaagcaagatca
gttgaaaatagtgaatattctagcaaaaggtatcgagcggggagtactttacatagcgcg
tattgtcgaagaataaggaatgataaggactggacaacatgcacaagtgtcgcacagtac
cagcaagccaaagcggctcataactaccaccgatacaaaagaaaggttcaccaagtttct
ccgcgtcggaagaggaacgtacatgagatcttcgagtactgtgctggcgaagctaagtcc
gaattggatacggaaggctcaagcatttttgaaggacttcatttttacatattgagcgat
tacgtcacttcgcagagaaggaggtatgagagaggaatggttgctgccaaagtcgttaaa
catgggggacttattgttaagaacattgacatgcgaccagagcacttaagttatttgcgc
attgttagcgggaaaaccacaatcgagtgccgcaatcttgttaacaggggatatgacatc
attgacccttgctggatatttgactgcatttctgccgggttccaacttggaattgaacca
aagcattgcttccagacgtcacgcagactgcttgacaatagccgccagagagttgatcaa
tacggcgacagtttttctcgtcctttagataccacggagttccagcagctcttcaaattt
ttttgctcctcaccttctgatttttcttcccgcattagttcaatgcttcaagacgatctt
gatgaggcgccactcttccttctacagagattcaaaatttacgtcttggcagcagacctg
attccccaacaattctcaatcctgagaagaaagatagaactctacggcggggtggtctct
gagacccttgaaggtgcgaatttagtgctagtcccctcagctttgtcaacagcgcgcact
gcctactatgttcaagaattgagacagaaaatcgcaggaaacgcctttgcagggaatacc
aataccagaatcccacacatagtaagatctgagtggctcgacacgtgcaccactgaacaa
tgtctagttcctgaggaagatttttcgtcaatataa

DBGET integrated database retrieval system