KEGG   Lachancea thermotolerans: KLTH0C11660gHelp
Entry
KLTH0C11660g      CDS       T01117                                 

Definition
KLTH0C11660p
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lth  Lachancea thermotolerans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    KLTH0C11660g
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    KLTH0C11660g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     KLTH0C11660g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:960335..962890
Genome map
AA seq 851 aa AA seqDB search
MSNDAFATSLHGDEIITGQHVRQQPWIKSTDESKLVLLNENCARYTSNSVKGSPPQRSVK
SSFRRILRRTTNYIPRSKAQKNPAFLGPMTYNQAYLSRNVEKANQFARDEGLLRDMYHRL
QVGIYMTKITRKKQVDHVFTINDGMLSWRESKSIDLDTIKDVRCGEMAKNYIEDYKASPS
TARLWITIIYQVSSKFRALHVVARNLDDLECFYLGIVNLVDSRRNLMKSIKNPEDDMFAN
IHWHASVSSEKCAESVEVLSFNDVKTLCSKFSIFCSDVYLREVFNTADANSNGLLNFTEF
QKFVKLLKERKELSRIWLNITNGEAMLTLEGFGRFVRQAQHEEINSETVFKEFNKFKQDN
CLMSLDGFQKYLSSQPYLRDVDMDYSMPINKYFISSSHNTYLQGKQLGESPTVETYIHAL
QQGCRCIEIDIWDGEDGPVVCHGKLTGSLPLQNVIRVVRKYAFMTSPYPLILSLEIHCKP
VNQLVTERILRDLLGDQIYHGSENGRLVSPSKLKHKFLIKVKKSSTVRATPDDEPTSSTS
ASSSYDSEIDSQKTTGRRLSISKKIHVIESLVAASAIHGVKFRNFSLPESKVPNHCFSLS
EKKLDNLGKDEAQRLAIDKHNRRFLMRVYPHALRYRSSNFNPIRFWEAGVQMVATNWQTY
DLGQQLNKAMFQLPLEESSLWHSGYVLKPSYLARDVNKTNEIEDLYASLKSKTMILSIEV
LSAQLLPKPKTLKQKQSSYNFSVKLEVHSNMPVETFEVFNGVTTSESSGSTQCCKENGFT
PTWEALFKVTLADTFFNFLLFTVKAGDTDLASCCLKVDYLRKGYRHVPLYSGSGERFIFS
TLFLGVNYYYV
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgatgcttttgctacttctttacacggcgatgagattataactggccagcac
gtaagacaacagccgtggatcaagagcacagatgagagcaaattggtgctactaaatgaa
aactgcgctcgttatacgagcaactctgtgaaaggaagcccgccacaacgctctgtgaag
agtagtttccggagaattttgcgcagaaccacaaactacatcccgcgctccaaggctcaa
aaaaaccctgcatttttgggtcctatgacctacaatcaggcttatctttctagaaatgtt
gaaaaagcaaaccagtttgctagggacgaaggccttttaagagacatgtatcataggcta
caagtgggcatttacatgacaaagattactcgaaaaaaacaagtggatcatgtgtttact
ataaatgatggcatgctatcttggcgcgaatctaaaagtatagacctcgatactatcaaa
gatgtccggtgtggtgagatggccaaaaattacatcgaagattataaagcatctccatcc
actgctcgtctctggattactatcatttaccaagtttcctcgaaattccgtgcactccat
gtcgtagctcgtaacctagatgacctagagtgcttctaccttggtattgtcaacttggtc
gattcgagacgtaatttgatgaagagcataaaaaacccggaagatgacatgttcgcgaat
atacattggcatgcaagtgtgtcctcagaaaagtgtgctgaaagtgtcgaggtcttgtct
tttaatgatgtcaaaactctttgctcaaagttcagtatattttgctcggatgtttattta
agagaggtcttcaatactgcggatgctaactctaatggtttgcttaacttcacggaattt
caaaaatttgttaaactgctgaaagaaaggaaggagctgtccaggatatggcttaatatc
acaaatggggaggcaatgttaacgttggaaggatttggtcgatttgtccggcaagctcaa
catgaagaaattaattctgaaactgttttcaaagaatttaataagtttaaacaagacaat
tgcttgatgagcctagacggttttcaaaaatacttgtcatcacaaccttacttgcgcgat
gtcgacatggattactcaatgcccatcaacaaatacttcatttcatcctcacacaacacc
taccttcaaggcaaacaactcggagagtctccaaccgttgaaacctatattcatgcttta
cagcagggctgccgatgtattgaaattgatatatgggatggggaagatggccctgtagtt
tgtcatggaaaattgacgggctctttgcctttgcagaacgttattcgtgttgttagaaaa
tacgcattcatgacatccccttaccctttgatactatcattagagattcactgcaagcct
gtaaatcagctagtaactgaacgtattttaagggatctcttgggggatcaaatttaccat
ggttctgaaaatgggagacttgtctcaccttcaaagctgaagcataagtttttgattaaa
gtcaaaaaatcaagtacagttagggctacacccgatgatgaacccacctcctcaacttcc
gcgagctcatcatatgattccgagattgactctcaaaaaacaactggaagaagactgagc
atatcaaaaaaaatccacgtaattgagagtttagtggcagcatccgcaattcatggggtg
aagtttagaaacttctcgctaccagagtccaaagtccccaatcattgtttttcactcagt
gagaagaaacttgataatctagggaaagacgaggctcaaagattagcaatagataagcat
aacagacgttttttgatgcgtgtgtatccccatgcacttcgttatagatcgtcgaacttt
aatcctattagattttgggaggccggggtgcaaatggttgccaccaattggcaaacttat
gatctgggccaacaactgaacaaagccatgtttcagctaccgctggaagaatcttctctt
tggcactcgggttacgttttgaaaccaagctacttagcacgcgacgtgaataagacgaat
gagatagaagacctttatgcatcattgaaaagcaaaacaatgatcctctcaatcgaggtt
ctttctgcacagttacttcctaagcccaaaacactcaagcaaaaacagtcttcctacaat
ttcagtgtgaagcttgaagtacacagcaacatgcctgttgaaactttcgaagtttttaat
ggggtgaccactagcgagtcttccggctcaacacagtgctgcaaggaaaacggattcaca
cctacttgggaggccctattcaaagtgactttagcagatacctttttcaatttcttgtta
ttcacggtgaaagccggcgacaccgacctcgcctcgtgctgtttaaaagttgattaccta
agaaagggctatcggcatgtcccactatatagtggaagtggtgagcgattcattttttct
acgttgtttttaggcgttaactactattatgtttaa

DBGET integrated database retrieval system