KEGG   Lachancea thermotolerans: KLTH0D00946gHelp
Entry
KLTH0D00946g      CDS       T01117                                 

Definition
KLTH0D00946p
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
lth  Lachancea thermotolerans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLTH0D00946g
Translation factors [BR:lth03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    KLTH0D00946g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:89863..92082
Genome map
AA seq 739 aa AA seqDB search
MATSALEDIRIEDIPVDDVDFSDLEKKYEVESPVNFDNFVVVDGAPVAPESKVPVLTKVL
TKLFSQAGSVVDINLPLDEEKKTTKGYLFVEFDSPASARKAIKLLNGKKLDVKHRLFVNS
LTDVEKFGTEDFDTEFHEPKLPEFQKTDYLQSWLQDEQGRDQFVLQKGELTGVFWNRNTQ
QPENAVEPRTNWSNTTVKFSPKGTYLFSFHNQGVASWGGRNFERLRRFFHPQAKALAISP
TEKYLVTLSPEPIVVPEDAPEDFPFGPESNGHQLCVWDIATGLSVKTFALPPNQRLHWPM
IKWSFDDKYCARLGPNALAVYDAENNFELLGGRIMKIEGIQDFSFAPAGAKLAVNRNGEL
SSVLAFWTPESNNQSCKATVMEIPTRRVLRTVNLVQVSDVTLHWQNQAEYLCVKVDRHTK
SKKTFFSNLEICKLTEKDVPVEKVEMKDLAVRFAWEPKGHRFVTISTTETADDNPSIPKN
VVTFFAPEQKEKTNVAVKAEPKKWKAFASVPGKFSNTISWSPAGRFVVVATLVTPDTRKA
DFDFYDFDFTGDKNDNDSDDVAANLKAVAHPEFYSATDMQWDPSGRFVAVWSSAVKHKLE
NGYKVFNVAGECVREEMIEAFKNFVWRPRPESLLTNGEKKKVRKNLREWSAQFEELDAMQ
ADSAMRELILSRRSMLEGWTQYRQDRAALMEEEYNYKVFDQVEHSTADEDYEVVEEIKEE
ILEEKEEEVTSFEEPTSSE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtccgctttggaagacataagaattgaagacattcccgtcgatgacgtcgac
ttctctgatttagagaaaaagtacgaggttgaatcaccagtcaacttcgacaattttgtt
gttgttgatggtgccccggtagctccagaatctaaagtcccagtgcttacaaaagttctg
accaagttattttcgcaagctggctcggtggtggacattaatttgcctttggatgaagaa
aagaagaccactaagggctatctgttcgttgagtttgattcaccagcttcagctagaaag
gcaatcaagctgttgaacggcaagaagctggatgttaagcatagactttttgttaacagc
ttgaccgacgtcgagaagtttggaacagaggattttgacactgagttccatgaaccaaaa
ttgccagagttccaaaagacagattatttgcaatcgtggttgcaggatgaacaaggaaga
gaccagtttgtgctacagaagggcgaattaactggtgttttctggaacagaaacactcag
caacccgaaaatgccgtggagcctagaacaaactggtctaacaccacagtcaaattctct
ccaaagggtacttacttgttctctttccacaaccaaggtgtcgcctcgtggggtggtagg
aattttgagcgtttaaggagatttttccatcctcaggctaaagctttggctatttctcca
accgaaaagtaccttgtgactttgtcaccagagcccattgttgttccagaagacgctccc
gaagacttcccattcggccctgagtcaaacggccatcagctatgtgtttgggatattgct
actggtctttctgtcaagactttcgcactccctccaaaccagagattgcactggcctatg
ataaaatggtcctttgacgataagtactgtgcacgtctagggccaaacgctcttgccgtt
tatgatgccgaaaacaacttcgagctactgggcgggagaattatgaagattgaaggtatc
caagacttctcgttcgcccccgcaggcgccaagctcgccgtcaacagaaatggcgagctc
tcttccgtcttggctttctggactccggaatcgaataaccagtcttgtaaggctaccgtt
atggagatccccactagaagagttttgaggactgtcaacttggtccaggtctccgacgtg
actttgcactggcaaaaccaagccgaatacttgtgtgtaaaggtggaccgtcataccaag
tctaaaaagactttcttttccaacttggaaatctgcaagcttactgagaaggacgtcccc
gtcgagaaggttgaaatgaaggatcttgccgtcagatttgcttgggaaccaaagggccac
agatttgttacaatctccacaactgagaccgctgacgacaacccatccattccaaagaac
gttgttaccttcttcgcacccgaacaaaaagagaaaaccaatgttgcagtcaaggctgaa
cctaagaaatggaaggcatttgcctccgtgcctggtaaattttctaacaccatttcatgg
tctcctgccggtagatttgttgttgttgcaaccctagttactccagacacaagaaaagct
gacttcgacttctacgacttcgacttcactggtgataagaatgacaacgacagtgatgat
gttgcggcgaacctaaaggccgtcgcccatcctgaattttacagtgccactgatatgcaa
tgggacccatcagggagatttgttgctgtctggtcctctgccgtgaaacacaagctcgaa
aacggttacaaggttttcaacgttgcaggcgaatgtgttagagaggaaatgatcgaggct
tttaagaactttgtttggagaccaagacctgaatctctactgaccaacggtgagaaaaag
aaggtgagaaagaacctgagagaatggtctgcccagttcgaggagctggatgccatgcaa
gcggatagtgctatgagagaattgatcttgtctcgccgttcgatgttggaaggctggacc
caatacagacaagacagagccgcgctcatggaggaggagtacaactacaaggtattcgat
caagtcgagcactctaccgccgacgaagattacgaagtggtcgaagaaatcaaggaggag
attttggaagaaaaggaggaggaggtcacttccttcgaagagcctacaagttccgaataa

DBGET integrated database retrieval system