KEGG   Lachancea thermotolerans: KLTH0D02266gHelp
Entry
KLTH0D02266g      CDS       T01117                                 

Definition
KLTH0D02266p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lth  Lachancea thermotolerans
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:lth00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(225886..228108)
Genome map
AA seq 740 aa AA seqDB search
MSSTGFSDRTSDGSLKQRNVSKIDQISDSEAEDAPKDIKVQTSPLAHLESIVMPIVFTLL
GFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWIAGYNGSW
DFPSGEEYPEYLDYVKMRIFNATFSALCIPVAYFTAKAIGFSLPTVWLFTILVIFENSYA
TLGRFILLDSMLLFFTVTSMLCFVTFHNQRSKPFSRKWWKWLLLTGLSLGCAISVKMVGL
FIITLVGIYTVIDLWTMLSDKGVSKKTYVNHWLARILCLIIVPFLVFLACFKVHFDLLSH
SGTGDANMPSLFQAGLVGSDVGVGPRDVALGSSHVSIKNQALGGSLLHSHVQGFPEGSNQ
QQVTCYGHKDSNNNWIFDRIRPLPFWTEEETEIEYVVPGESYRLVHPNTGKNLHTHPIPA
PISKSAWEVSGYGSATVGDPKDHWVLEVVAQYGSENQSRVHPLTSSFRIKNAELGCYLAQ
TGESLPEWGFRQSEVACLKNPFKRDKRTWWNIESHTNERLPDRPADFQYPKLNFIKNFIH
LNLAMMATNNALVPDPDKLDTLASSAWQWPTLNVGIRLCGWGDETVKYFLMGSPASTWPS
TAGVLAFMVLVVVLLLRWQRQYADFSSPRDFNLFMMGGFYPLLGWGLHFMPFVIMSRVTY
VHHYLPALYFALLILCYLFEAGLKNLQKHKGGRLARTLIYFTYGAIVICGFYYFSPISFG
LVGPSSNYAYLNWIKTWTIK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgactggttttagtgacagaactagcgatggctcactgaagcagcgaaacgta
tccaagattgaccagatttcggactcagaagctgaggatgcacccaaagatataaaggtg
caaaccagccctctggctcacttggaaagcattgtgatgcccatcgtgttcacgctccta
gggttcttcacaaggatgtacaaaatcggcgtcaacaaccacgttgtgtgggacgaagcg
catttcgggaaattcggttcgtactacctgagacacgagttttaccatgacgtgcacccc
cctcttggcaagatgctggtgggtctatcaggctggattgctggttacaatggctcatgg
gactttccctccggggaggagtacccagaatacctggattatgttaaaatgcggatcttc
aacgctacgttttctgcgctctgtatccctgttgcttattttactgcgaaggcaattggt
ttttccctgccaactgtttggctattcacaatcttggttatttttgaaaactcttacgcg
accctgggaagattcattctgctggactccatgttgttgttctttactgtgacatcgatg
ctctgcttcgttaccttccataaccagagatctaagccattctccagaaaatggtggaaa
tggcttctgttaacaggtttatcactaggctgtgccatctcggttaaaatggtcggtctt
ttcattatcactttggttggtatctacactgtgatcgacttgtggaccatgctgagcgac
aaaggggtttccaagaaaacctatgtcaaccactggctagctagaattttgtgcttgatt
attgttccatttttggttttccttgcttgcttcaaagttcattttgacttactgtctcac
agcggtactggtgatgctaatatgccttctcttttccaagctggtttagtgggctccgac
gttggagttggcccacgtgacgttgcattaggctcttctcatgttagcataaaaaatcag
gctttaggcggctctctgctgcactcacacgtccaaggtttcccagagggctctaaccag
caacaggttacttgctatggtcacaaggacagcaacaataattggatttttgacagaatt
agaccacttccattttggactgaggaagaaactgaaattgagtatgttgtgccaggtgag
tcctatagattggttcatcctaacacaggtaaaaacctgcacactcaccccattcctgct
ccaatttccaagtctgcatgggaagtttcgggctacggttcagccactgttggcgaccct
aaagaccactgggttttggaagttgtagcacaatatgggtctgagaaccagtcccgtgtg
catccattgacgtcttcgttccgtataaagaacgccgagcttggctgctatttggctcag
acgggagaatctttgcctgagtggggtttcaggcagagcgaagttgcctgtttgaagaat
cccttcaagagagacaagagaacttggtggaatatcgaaagtcacacgaatgaaagattg
cctgatagaccagcagatttccagtacccaaaactgaacttcatcaagaatttcattcat
ttgaacctggctatgatggcaaccaacaatgctttagttcctgaccccgacaaattagac
acattagcttcatctgcttggcaatggccaactttgaatgttggcatcagactctgtgga
tggggagacgaaaccgtgaagtactttttgatgggttctccagcttccacatggccttca
accgctggtgttctggcttttatggttttagtagttgtactccttttgagatggcaaagg
cagtatgctgacttctcaagcccacgcgacttcaacctatttatgatgggcggtttctac
ccattgttggggtggggcttgcatttcatgccgtttgtcataatgagcagagtcacttat
gtgcaccactacctgcccgccttgtatttcgcattgctgattctctgctacttatttgaa
gcaggtttgaaaaacctgcaaaaacacaaggggggccgtttagcaagaaccctcatttac
ttcacctatggtgctattgtaatttgcgggttttactacttttctcccatttcttttggc
ctagtcggtccttcaagcaattacgcctacctgaactggatcaagacctggacaatcaaa
tag

DBGET integrated database retrieval system