KEGG   Lachancea thermotolerans: KLTH0D04026gHelp
Entry
KLTH0D04026g      CDS       T01117                                 

Definition
KLTH0D04026p
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lth  Lachancea thermotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KLTH0D04026g
Enzymes [BR:lth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     KLTH0D04026g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLTH0D04026g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:387535..388557
Genome map
AA seq 340 aa AA seqDB search
MHTAEFLDAHPTEISSILAGGYNHPLLREWQNERQLTKNMFIFPLFISDDADEETPIDSL
PNIKRFGVNRLAQYLAPLIEKGLKAVILFGVPMKEGCKDQYGTAADDPEGPVIQGINLLR
REFPDLYIICDVCLCEYTSHGHCGVLYDDGSINREESVRRIAAVAVNYAKAGAHSIAPSD
MIDGRIRDIKYGLIKAGLAHKTFVMSYAAKFSGNLYGPFRDAACSSPSSGDRKCYQLPSG
GRGLARRALRRDLDEGTDGIIVKPSTFYLDIMADASEIARDVPICAYHVSGEYAMLHAAA
EKGVVDFKTIAFESHQGFLRAGARLIISYLTPEFLEWLGQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcacactgcagagttccttgacgctcacccaactgaaatcagttcgatcctggctggg
ggatacaatcatcctttgctcagagaatggcaaaatgagcgccagctaactaaaaacatg
ttcatctttcctctgtttatctcagacgacgctgacgaagaaacgcctatcgactctctg
cccaacatcaaaagatttggtgtcaacaggcttgcacagtatttggctcctttaatcgaa
aaagggctaaaggccgtgatcttgttcggcgtgcccatgaaggaaggatgtaaagatcaa
tacgggactgccgcggatgatcccgagggcccagtcatccagggcattaaccttttgaga
cgcgagttcccagatctttacatcatctgcgatgtgtgtctatgtgagtacacctcccac
ggtcactgtggagtcttatacgacgacggtagcattaaccgggaggagtctgttcgtagg
attgccgcggttgctgtcaactatgcgaaagcaggagctcactctattgcgcctagcgac
atgattgatggcagaattcgcgacatcaagtacggactgattaaggctggcctggcgcac
aaaaccttcgtgatgagttacgccgccaagttcagcggaaatctctacggtcctttccgc
gatgctgcctgctccagcccctcgagcggagaccgcaagtgctaccagctcccatctggc
ggccgcggccttgctcgcagagccctgagaagagatttggacgaaggcactgacggtatc
attgtgaagccctccactttctacttggatatcatggcagacgcgtccgagattgcgcgc
gacgtccccatttgcgcttaccacgtctcaggcgaatacgcaatgttacacgcggcggcc
gaaaagggcgtggtggacttcaagactatcgctttcgaatcccaccagggcttcttgagg
gccggtgcaaggttgattatctcttacctcaccccggagttcctggagtggctaggccag
tga

DBGET integrated database retrieval system