KEGG   Lachancea thermotolerans: KLTH0D04026gHelp
Entry
KLTH0D04026g      CDS       T01117                                 

Definition
KLTH0D04026p
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lth  Lachancea thermotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:387535..388557
Genome map
AA seq 340 aa AA seqDB search
MHTAEFLDAHPTEISSILAGGYNHPLLREWQNERQLTKNMFIFPLFISDDADEETPIDSL
PNIKRFGVNRLAQYLAPLIEKGLKAVILFGVPMKEGCKDQYGTAADDPEGPVIQGINLLR
REFPDLYIICDVCLCEYTSHGHCGVLYDDGSINREESVRRIAAVAVNYAKAGAHSIAPSD
MIDGRIRDIKYGLIKAGLAHKTFVMSYAAKFSGNLYGPFRDAACSSPSSGDRKCYQLPSG
GRGLARRALRRDLDEGTDGIIVKPSTFYLDIMADASEIARDVPICAYHVSGEYAMLHAAA
EKGVVDFKTIAFESHQGFLRAGARLIISYLTPEFLEWLGQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcacactgcagagttccttgacgctcacccaactgaaatcagttcgatcctggctggg
ggatacaatcatcctttgctcagagaatggcaaaatgagcgccagctaactaaaaacatg
ttcatctttcctctgtttatctcagacgacgctgacgaagaaacgcctatcgactctctg
cccaacatcaaaagatttggtgtcaacaggcttgcacagtatttggctcctttaatcgaa
aaagggctaaaggccgtgatcttgttcggcgtgcccatgaaggaaggatgtaaagatcaa
tacgggactgccgcggatgatcccgagggcccagtcatccagggcattaaccttttgaga
cgcgagttcccagatctttacatcatctgcgatgtgtgtctatgtgagtacacctcccac
ggtcactgtggagtcttatacgacgacggtagcattaaccgggaggagtctgttcgtagg
attgccgcggttgctgtcaactatgcgaaagcaggagctcactctattgcgcctagcgac
atgattgatggcagaattcgcgacatcaagtacggactgattaaggctggcctggcgcac
aaaaccttcgtgatgagttacgccgccaagttcagcggaaatctctacggtcctttccgc
gatgctgcctgctccagcccctcgagcggagaccgcaagtgctaccagctcccatctggc
ggccgcggccttgctcgcagagccctgagaagagatttggacgaaggcactgacggtatc
attgtgaagccctccactttctacttggatatcatggcagacgcgtccgagattgcgcgc
gacgtccccatttgcgcttaccacgtctcaggcgaatacgcaatgttacacgcggcggcc
gaaaagggcgtggtggacttcaagactatcgctttcgaatcccaccagggcttcttgagg
gccggtgcaaggttgattatctcttacctcaccccggagttcctggagtggctaggccag
tga

DBGET integrated database retrieval system