KEGG   Lachancea thermotolerans: KLTH0D05060gHelp
Entry
KLTH0D05060g      CDS       T01117                                 

Definition
KLTH0D05060p
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lth  Lachancea thermotolerans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0D05060g
Enzymes [BR:lth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     KLTH0D05060g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(456032..456922)
Genome map
AA seq 296 aa AA seqDB search
MSVEETDTEVILTHPENSKTFVKILKYGATVYSWSLEGQEQLWLSSAAKLDGSKPVRGGI
PLVFPVFGKNEDDEFLSKLPQHGLARNSTWEFLGQVSANPPTVQFGLGPELANPELTKLW
PMDYSLILTVELGSGHLKTHIEVSNTSSSQPLKFNWLFHTYLKIADIEDTLVSNLTGAKL
YDQMLQESYVDRQPVVSFHEELDRIYQRVQEDRLIQVIDKGHPIHTVKRHNLPDVVTWNP
WVEKSKGMADFEPKSGFKEMVCVESGHVHSLLELQPGQSWTAYQLLYKDELNYQVL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagaagaaacagataccgaagtcatcctgacgcatcctgaaaacagcaagacc
tttgtcaagatcctcaagtatggcgctactgtctactcctggagtctagagggccaagaa
cagctgtggttatcctcagctgccaagctggacgggtcaaagcctgtgcgtggtggtatt
ccattggtgtttcctgtatttggaaagaacgaggatgatgagttcctcagcaaactgccc
cagcatggcctagccagaaactctacttgggagtttctgggccaggttagcgctaaccct
cctacggtgcagtttggactgggccccgagttggctaaccccgagctgacaaagctatgg
ccaatggactactctttgattttgacggtcgaactaggctcggggcacttgaagacgcac
atcgaggtgtcaaacacttctagctcgcaaccgctgaaattcaactggctgttccacacc
tacctcaagatcgcggacatcgaagacactctagtgtccaacctaacgggtgccaagctt
tacgaccaaatgctgcaggagtcctacgttgacagacagcccgtggtttcgttccacgag
gaactggaccgcatctaccaaagggtgcaggaggaccgtctaatacaggtcatcgacaag
ggccaccctatacacaccgtcaagaggcacaatctgcccgatgtcgtgacctggaatcca
tgggtcgagaagtccaagggaatggcagacttcgagcccaagagcggattcaaagagatg
gtatgcgtggaatccggccatgttcacagccttctggagctacaaccaggccagagctgg
accgcataccagctgctctacaaggacgaactcaactaccaagtgctttga

DBGET integrated database retrieval system