KEGG   Lachancea thermotolerans: KLTH0D05588gHelp
Entry
KLTH0D05588g      CDS       T01117                                 

Definition
KLTH0D05588p
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KLTH0D05588g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0D05588g
  Lipid metabolism
   00071 Fatty acid degradation
    KLTH0D05588g
  Amino acid metabolism
   00350 Tyrosine metabolism
    KLTH0D05588g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KLTH0D05588g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(502176..503345)
Genome map
AA seq 389 aa AA seqDB search
MQRTLYRHTSSTLMQGVRQRLGGYAGLGSQRIGFVGALRFASNIPSMQKGVIFYEHGGEL
HYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVAKGEN
VTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLSGYTHDGSFQQYATADAVQAAQ
IPKGTDLAQIAPILCAGVTVYKALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGLRVL
GIDGGEDKKKLFHDLGGETFIDFRTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEY
VRPTGSVVLVGLPANAYVKSEVFSHVVKSISIKGSYVGNRADTREAIDFFARGLVKAPIK
IIGLSELPEAYKLMEAGKILGRYVVDTEK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaacattatacaggcacaccagtagcacgctgatgcagggagtgcgccagagg
ctcggcggctacgcgggtctgggaagccagcgcatcgggtttgtcggcgcgctgcggttc
gcatcgaacatcccttcaatgcagaagggtgttatcttctacgagcacggcggcgagttg
cactacaaggacttgcctgtgcccaaacctaagcctaacgagattctaataaacgtcaag
tactctggggtgtgccacacagacttgcacgcctggaagggagactggcctcttgccgtc
aagcttcccctggtcggtggccacgagggtgccggtgtagtcgttgccaagggcgaaaac
gtcacaaactttgaaatcggcgattacgccggtatcaaatggctcaatggctcgtgtatg
agttgcgaattgtgcgagcagggcaatgagcccaactgcgagcacgcagatctttctggt
tacacgcacgacggttccttccagcagtacgccactgcggacgctgtgcaggcggctcaa
atccccaagggcactgacctcgcacagatcgcccctattttgtgcgccggtgttaccgtc
tacaaggccttgaagactgcggatgtcagacccggccaatgggttgccatctccggcgca
gctggtggattggggtctctggccgtccagtacgccaaggcaatgggcttgcgtgtcctt
ggtatcgacggtggtgaggacaaaaagaagctcttccacgacttgggcggtgaaaccttc
atcgacttcagaaccactaaggacatggtgggcgcgatccaagaagccacccaaggtggc
ccccacgctgttatcaatgtttccgtttccgaggctgctatctccatgtcaactgaatac
gtcagacctacgggctctgtcgttttggttggtttaccagctaacgcatacgtgaagtcc
gaagtgttttcgcatgtggtcaagtccatttctatcaagggatcctacgtgggtaaccgt
gcggacactagagaggctatcgatttctttgcgagaggtcttgtgaaagctcccatcaag
atcattggtctttcggaactacctgaagcctacaagctgatggaggctggcaagattctc
ggcaggtacgtggttgataccgaaaaatga

DBGET integrated database retrieval system