KEGG   Lachancea thermotolerans: KLTH0D06116gHelp
Entry
KLTH0D06116g      CDS       T01117                                 

Definition
KLTH0D06116p
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
lth  Lachancea thermotolerans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lth00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(543221..544486)
Genome map
AA seq 421 aa AA seqDB search
MSSHLQKPVVRTRRTSSVGAINLGDNKVPGLSTMKESEQSKTAALARMRALSEASKGDVD
LLKKFYLTYREMSYRHTWLTPLVILLAVYGAYFLSGNRTASNPLHPFVAISYQVGDSDMY
GKGIGDLCFVFYYMVFFTFLREFLMECVLRPLASALGVTGEHKTKRLMEQAYSIIYYGIS
GPFGLYIMYHTDLWLFRTAPMYATYPDLTNQYLYKVFYLGQAAFWTQQACVLVLQLEKPR
KDFKELVFHHIVTLALIWLSYVFHFTKMGLAVYITMDVSDFFLSLSKTLNYLDSALTAPV
FFVFVASWTYLRHYINLKILWSVLTEFRTVGDYTLNFATQQYKCWISLPIVFVLISALQL
VNLYWLFLVMRILYRLLFKGIQKDERSESESEETVQVDKHENDENEKTMEGNPDPALKKE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacacctccagaaacctgtagtaaggactaggaggacatcctctgttggcgcg
atcaacctaggtgacaacaaagtccctggtttgtcgacaatgaaggaatcagagcagtcg
aaaacagctgccctcgcaaggatgagggctctatctgaagcctcaaagggcgatgttgat
ttgctaaagaagttctatttgacttaccgtgagatgagttaccgccatacatggcttact
cctttggtgatacttctggctgtgtatggcgcttactttttgtctggcaatcggaccgct
tcgaaccctttacatccgtttgttgcaatttcctatcaggttggagactctgatatgtat
gggaaaggtattggggatctgtgttttgtgttttattatatggtcttcttcacctttttg
cgcgagttcttaatggaatgcgtgttgcgtcctttagcctctgcattaggtgtgacaggc
gaacacaagacaaagagacttatggagcaagcttactcgatcatctactatggtatatca
ggaccattcggcctctatatcatgtaccacactgatttatggctatttcgcactgcgccc
atgtatgcgacctatcccgatttaacaaatcaatatttgtacaaggtgttctacttaggc
caggctgccttttggacacagcaagcgtgcgttctggttctgcagttggaaaaaccaaga
aaggacttcaaggagctagtttttcatcatatcgtcactttagctttaatctggctgtcc
tacgtttttcacttcacaaaaatgggcctcgctgtctacataacaatggacgtgtcggat
ttcttcctctctctatccaagactctcaactacctggattcggcccttactgctccagtt
ttcttcgtgttcgttgcctcttggacttacttgcgccattatatcaatttgaaaattctg
tggtcagtgctaaccgaattccgcactgtgggtgactacactttaaacttcgccactcaa
caatacaagtgttggatatcgcttccaatcgtttttgttttgatatctgctcttcaactg
gtgaacttgtattggctcttcttagtcatgcgtatcttatatcgtttactgttcaaagga
attcagaaagacgagagaagtgagagtgagtctgaagaaacagtgcaagtggacaaacat
gaaaacgatgaaaacgaaaagaccatggaaggcaatcctgacccggcgttgaaaaaggaa
aattaa

DBGET integrated database retrieval system