KEGG   Lachancea thermotolerans: KLTH0D06138gHelp
Entry
KLTH0D06138g      CDS       T01117                                 

Definition
KLTH0D06138p
Orthology
K04705  
signal transducing adaptor molecule
Organism
lth  Lachancea thermotolerans
Pathway
Endocytosis
Module
ESCRT-0 complex
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    KLTH0D06138g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:544661..546130
Genome map
AA seq 489 aa AA seqDB search
MSSNQSLRDAILRATDGKLRVDNWQFIIEVCDLVREDPEDRGRFATDIVEERLKEDDANV
VLRTLSLVVSLAENCGSRLQQAISSKGFTKVLYGLIENPKVHLVVKREVAKVVEQLSDSF
KNDSSLKSMQDLYVAISAQAPHLLVRERVPQKKEMSHETKRNEEKELEEALKLSILEYEQ
SSSQKAAQNNDNKVANQKHIESSHHNESQTQNTVRKVRALHDLTGRESDELSFRKGDIIV
VIEQVYKDWWRGRLRGRVGIFPLNYVTPVAEKTPEQLRQQKAHEDAVFSQISNVDKLHRR
MAENANDLELTQDGEVNNLYSVVTPLRPQLTKMIGDYAQKKEEYSSLRKVLADAEASYNR
MLDRASQVYPTQSLPLERMGSGSYEQPVGLQHTHSRQASAVNPLSRQPQSGIPYVHAQSF
LTGQPQPNQHQTHSLKLQQREQRQSPHQIPELYQQGPQNYQRQPQNTHPSETRPVHQVPY
PMSNQATGI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaatcagagcttaagggatgcgatattgcgagctacggatggaaagttgcgg
gttgataactggcagtttatcatcgaggtgtgcgacttagttagggaagatccagaagac
aggggtcgctttgccacggatattgtagaggagcgactaaaggaggatgacgctaatgtc
gtgctacgtacattatctcttgtcgtatcgctggcagaaaattgcggttcaagacttcaa
caagctataagttccaagggcttcacgaaagtcctatatggccttatagagaacccaaag
gtgcatttagttgtcaaaagggaagtcgccaaggtagttgagcaactgagcgactctttc
aaaaatgactcatcactgaagtctatgcaagacctgtacgtggcaattagtgctcaagcg
ccgcatctccttgtccgagagagggttcctcagaagaaagaaatgagccatgaaacaaag
cgcaacgaagagaaggagctggaggaagccttgaagctttcaatacttgaatatgagcaa
tcaagttcacagaaagcagctcagaacaatgataacaaggtagcaaatcagaagcatatt
gaatcatcacatcataacgagtcgcaaacccagaacacggtaaggaaagtccgcgctctt
catgatctcactggcagggaatctgacgaattatcatttcgcaagggagatataattgtc
gtgatcgaacaggtgtataaggactggtggaggggccgactgcggggtagggttggaatc
ttccctttaaattatgttacccctgtagcagaaaagactcctgagcaactacgccagcaa
aaagctcatgaagatgcggttttcagtcaaatttcaaacgtggacaagcttcatagaaga
atggccgagaatgctaatgacctcgagttgacccaagatggagaggttaacaacttgtac
agcgttgtgacccctcttcgaccacagcttacaaaaatgataggagactatgctcaaaag
aaagaagaatactcatcgctgcggaaagtcttagcagatgcagaggcttcttataatcgc
atgctagatagagctagccaagtgtatccaactcagagtctgccgctcgaacgaatgggt
agtggaagctacgagcagcccgtagggcttcaacatacacacagtcgccaggcttctgca
gttaatcctttgagccgccagcctcaatcaggcattccgtatgtacacgctcaaagtttc
ctgacggggcagcctcaacctaatcagcaccaaacacactctcttaagctacagcagagg
gagcagcgtcagagcccgcaccagattccagaattatatcagcagggtccccaaaactac
cagcgacagcctcagaatacacacccctctgaaactcgaccagtgcaccaggttccttat
ccaatgagtaatcaagccacaggtatatag

DBGET integrated database retrieval system