KEGG   Lachancea thermotolerans: KLTH0D07238gHelp
Entry
KLTH0D07238g      CDS       T01117                                 

Definition
KLTH0D07238p
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lth  Lachancea thermotolerans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KLTH0D07238g
   00052 Galactose metabolism
    KLTH0D07238g
   00500 Starch and sucrose metabolism
    KLTH0D07238g
   00520 Amino sugar and nucleotide sugar metabolism
    KLTH0D07238g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KLTH0D07238g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(633807..635306)
Genome map
AA seq 499 aa AA seqDB search
MMQAKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSVKDEDTRSKFEGELDSFFSLFR
RYLVEKASGSTLEWDKIKSPNPEEVVDFSVIEQQPENVSNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDADTAHLIKKYSANRIR
IRSFNQSKFPRVYKDSMLPVPSSYNDELDSWYPPGHGDLFESLHASGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVP
KEHVDEFKNIRKFKNFNTNNLWINLKAVKKLVESSSLEMEIIPNQKTINRGGHEINVLQL
ETACGAAIRHFQGAHGVVVPRSRFLPVKTCSDLLLVKSDLFCLEHGALKLDPSRFGPNPL
IKLGSHFKKVSGFHARIPHIPKIVELDHLTITGNVFLGKGVTLKGTVIIVCSEGQRIDIP
NGSVLENVVITGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagctaagaaacacactaagacccactctacttatgcctttgagagcaacaca
aacagcgtggcggcgtcccagatgaggaatgctctgaacaagctggcggattcggttaaa
gacgaagacacgcgcagcaagttcgaaggggagctcgattcgttcttctccttattcaga
aggtatttggttgagaaggcttccgggagcactttggagtgggacaaaatcaagtcccct
aaccccgaagaggttgttgacttttccgtcattgagcagcagccggagaatgtgtccaac
ttgtccaagttggcagttctgaagctgaacggtgggctgggcacatccatgggctgcgtg
ggccctaagtctgttattgaggttcgcgatggcaacacgtttttggatttgtcggtgcgc
cagatcgagtacctgaacaggcagtacgacagcgacgttcctttgctgctgatgaactct
ttcaacacagacgccgatactgctcatctaattaagaagtactctgcgaacaggatcaga
attagatctttcaaccagtcgaaattcccacgtgtttacaaggactcaatgttgcctgtg
ccttcttcgtacaatgacgaacttgactcctggtacccaccaggtcacggtgatcttttc
gagtcactgcatgcttcgggcgaactcgacgcattgattgctcagggcagagagattcta
ttcgtctcaaacggtgacaacttgggcgcaactgtcgatttgaagattctgaatcacatg
atcgagacaggcgctgaatacataatggagttgaccgacaagactagggctgacgttaag
ggaggtactctcatctcctatgacggacaagtgcgccttttggaagtggctcaggtccca
aaagagcacgtcgatgaatttaaaaacattcgcaagttcaagaacttcaacaccaacaac
ttatggatcaacttgaaggctgttaagaaacttgtcgagtcgagcagtttggaaatggaa
attattccaaaccaaaaaaccatcaacagaggagggcacgagatcaatgttcttcagctg
gaaacggcttgcggtgctgcaatcagacatttccagggcgcccacggtgtggtcgtgcct
agatctagattcttgccagtcaagacctgctctgacttgctgttggttaaatccgacctg
ttttgtcttgaacacggggctctaaagctcgatccctcgagattcggacctaatccttta
atcaagttgggatctcacttcaagaaggtttctggattccacgctagaattcctcacatc
cccaagattgtggaacttgaccacctaaccataaccggtaacgtcttcctgggtaagggc
gttacactcaagggaaccgttatcattgtctgttcggaaggccaaagaatcgacattccc
aacgggtcagttctggagaatgtggtaatcactggaaacctgcagatcctagagcactga

DBGET integrated database retrieval system