KEGG   Lachancea thermotolerans: KLTH0D07238gHelp
Entry
KLTH0D07238g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D07238p
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lth  Lachancea thermotolerans
Pathway
lth00040  Pentose and glucuronate interconversions
lth00052  Galactose metabolism
lth00500  Starch and sucrose metabolism
lth00520  Amino sugar and nucleotide sugar metabolism
lth01100  Metabolic pathways
lth01130  Biosynthesis of antibiotics
Module
lth_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KLTH0D07238g
   00052 Galactose metabolism
    KLTH0D07238g
   00500 Starch and sucrose metabolism
    KLTH0D07238g
   00520 Amino sugar and nucleotide sugar metabolism
    KLTH0D07238g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KLTH0D07238g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 8295267
NCBI-ProteinID: XP_002553036
UniProt: C5DGQ6
Position
D:complement(633807..635306)
Genome map
AA seq 499 aa AA seqDB search
MMQAKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSVKDEDTRSKFEGELDSFFSLFR
RYLVEKASGSTLEWDKIKSPNPEEVVDFSVIEQQPENVSNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDADTAHLIKKYSANRIR
IRSFNQSKFPRVYKDSMLPVPSSYNDELDSWYPPGHGDLFESLHASGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVP
KEHVDEFKNIRKFKNFNTNNLWINLKAVKKLVESSSLEMEIIPNQKTINRGGHEINVLQL
ETACGAAIRHFQGAHGVVVPRSRFLPVKTCSDLLLVKSDLFCLEHGALKLDPSRFGPNPL
IKLGSHFKKVSGFHARIPHIPKIVELDHLTITGNVFLGKGVTLKGTVIIVCSEGQRIDIP
NGSVLENVVITGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagctaagaaacacactaagacccactctacttatgcctttgagagcaacaca
aacagcgtggcggcgtcccagatgaggaatgctctgaacaagctggcggattcggttaaa
gacgaagacacgcgcagcaagttcgaaggggagctcgattcgttcttctccttattcaga
aggtatttggttgagaaggcttccgggagcactttggagtgggacaaaatcaagtcccct
aaccccgaagaggttgttgacttttccgtcattgagcagcagccggagaatgtgtccaac
ttgtccaagttggcagttctgaagctgaacggtgggctgggcacatccatgggctgcgtg
ggccctaagtctgttattgaggttcgcgatggcaacacgtttttggatttgtcggtgcgc
cagatcgagtacctgaacaggcagtacgacagcgacgttcctttgctgctgatgaactct
ttcaacacagacgccgatactgctcatctaattaagaagtactctgcgaacaggatcaga
attagatctttcaaccagtcgaaattcccacgtgtttacaaggactcaatgttgcctgtg
ccttcttcgtacaatgacgaacttgactcctggtacccaccaggtcacggtgatcttttc
gagtcactgcatgcttcgggcgaactcgacgcattgattgctcagggcagagagattcta
ttcgtctcaaacggtgacaacttgggcgcaactgtcgatttgaagattctgaatcacatg
atcgagacaggcgctgaatacataatggagttgaccgacaagactagggctgacgttaag
ggaggtactctcatctcctatgacggacaagtgcgccttttggaagtggctcaggtccca
aaagagcacgtcgatgaatttaaaaacattcgcaagttcaagaacttcaacaccaacaac
ttatggatcaacttgaaggctgttaagaaacttgtcgagtcgagcagtttggaaatggaa
attattccaaaccaaaaaaccatcaacagaggagggcacgagatcaatgttcttcagctg
gaaacggcttgcggtgctgcaatcagacatttccagggcgcccacggtgtggtcgtgcct
agatctagattcttgccagtcaagacctgctctgacttgctgttggttaaatccgacctg
ttttgtcttgaacacggggctctaaagctcgatccctcgagattcggacctaatccttta
atcaagttgggatctcacttcaagaaggtttctggattccacgctagaattcctcacatc
cccaagattgtggaacttgaccacctaaccataaccggtaacgtcttcctgggtaagggc
gttacactcaagggaaccgttatcattgtctgttcggaaggccaaagaatcgacattccc
aacgggtcagttctggagaatgtggtaatcactggaaacctgcagatcctagagcactga

DBGET integrated database retrieval system