KEGG   Lachancea thermotolerans: KLTH0D09372gHelp
Entry
KLTH0D09372g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D09372p
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00220  Arginine biosynthesis
lth00330  Arginine and proline metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01230  Biosynthesis of amino acids
Module
lth_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KLTH0D09372g
   00330 Arginine and proline metabolism
    KLTH0D09372g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KLTH0D09372g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase EnY2
Motif
Other DBs
NCBI-GeneID: 8295356
NCBI-ProteinID: XP_002553119
UniProt: C5DGY9
Position
D:complement(776870..777832)
Genome map
AA seq 320 aa AA seqDB search
MLTEPSFDLYPNKKAGLVLANFSGGQGKSGVEDGPKYMLRQGLRQDLQELGWTTSIEEPL
ASDDYEKRKETDTSDVWGIVKRPQLVGEATKQIYESAKKVLERGEMPVTIGGDHSVAIGS
IAAVFEKHPDACVLWIDAHADINTPSTTDSGNLHGCPVSFLMGLDSENTPPSLQWVPKCV
KPNKIAYIGLRDVDAGEKRILRENHIPAFSMYHVDRFGLNHVIEMALQAINPDGDCPIHL
SYDVDAMDPLFVPATGTPVRGGLTLREGLFVAERVAETGKLVALDVVEVNPTLAVHDMHV
LDTVSAGCAVARCALGETLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttgacagaacctagtttcgatttgtacccaaacaaaaaggccggtctagtgctggct
aacttctcaggcggccagggaaagtccggcgtggaagacggccccaagtacatgctgaga
cagggcctaaggcaagatctgcaggaactcggctggacaacttccatcgaggagccactc
gctagcgacgactacgagaagcgtaaggagactgacacctccgacgtgtggggtatcgtc
aagagaccacagcttgtcggtgaggccaccaagcaaatctacgaatctgcgaaaaaagtg
ctggaacgcggtgaaatgcccgtgaccatcggcggcgaccactctgtcgccattgggtcc
atcgccgcggttttcgagaagcaccccgacgcgtgcgtactgtggatcgacgctcacgca
gacatcaacactccatccaccacagactccggtaacctgcacggctgccccgtctcgttt
ttgatgggcctcgactccgagaacacacctccctccctgcagtgggtgcccaagtgcgtg
aagcccaacaaaattgcatacatcggcctacgtgacgtggacgcaggtgagaagcgcatt
ctgagagagaaccacatcccagccttctccatgtaccacgtggaccgttttggcctcaac
cacgtgatcgagatggccttgcaggccatcaacccagacggtgactgcccaatccacctg
tcctacgacgtcgatgccatggaccccctgtttgttcctgctaccggaactccagtcaga
ggtggtctgacgctaagagaaggtctctttgtcgccgaaagagtcgctgaaacgggtaag
ttggtagctttggacgttgtcgaagtcaacccaacactcgccgttcacgacatgcatgtc
ctagacaccgtatcagctggctgcgccgtcgctcgctgtgctttgggagagactttgctg
taa

DBGET integrated database retrieval system