KEGG   Lachancea thermotolerans: KLTH0D09372gHelp
Entry
KLTH0D09372g      CDS       T01117                                 

Definition
KLTH0D09372p
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
lth  Lachancea thermotolerans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lth01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lth00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(776870..777832)
Genome map
AA seq 320 aa AA seqDB search
MLTEPSFDLYPNKKAGLVLANFSGGQGKSGVEDGPKYMLRQGLRQDLQELGWTTSIEEPL
ASDDYEKRKETDTSDVWGIVKRPQLVGEATKQIYESAKKVLERGEMPVTIGGDHSVAIGS
IAAVFEKHPDACVLWIDAHADINTPSTTDSGNLHGCPVSFLMGLDSENTPPSLQWVPKCV
KPNKIAYIGLRDVDAGEKRILRENHIPAFSMYHVDRFGLNHVIEMALQAINPDGDCPIHL
SYDVDAMDPLFVPATGTPVRGGLTLREGLFVAERVAETGKLVALDVVEVNPTLAVHDMHV
LDTVSAGCAVARCALGETLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttgacagaacctagtttcgatttgtacccaaacaaaaaggccggtctagtgctggct
aacttctcaggcggccagggaaagtccggcgtggaagacggccccaagtacatgctgaga
cagggcctaaggcaagatctgcaggaactcggctggacaacttccatcgaggagccactc
gctagcgacgactacgagaagcgtaaggagactgacacctccgacgtgtggggtatcgtc
aagagaccacagcttgtcggtgaggccaccaagcaaatctacgaatctgcgaaaaaagtg
ctggaacgcggtgaaatgcccgtgaccatcggcggcgaccactctgtcgccattgggtcc
atcgccgcggttttcgagaagcaccccgacgcgtgcgtactgtggatcgacgctcacgca
gacatcaacactccatccaccacagactccggtaacctgcacggctgccccgtctcgttt
ttgatgggcctcgactccgagaacacacctccctccctgcagtgggtgcccaagtgcgtg
aagcccaacaaaattgcatacatcggcctacgtgacgtggacgcaggtgagaagcgcatt
ctgagagagaaccacatcccagccttctccatgtaccacgtggaccgttttggcctcaac
cacgtgatcgagatggccttgcaggccatcaacccagacggtgactgcccaatccacctg
tcctacgacgtcgatgccatggaccccctgtttgttcctgctaccggaactccagtcaga
ggtggtctgacgctaagagaaggtctctttgtcgccgaaagagtcgctgaaacgggtaag
ttggtagctttggacgttgtcgaagtcaacccaacactcgccgttcacgacatgcatgtc
ctagacaccgtatcagctggctgcgccgtcgctcgctgtgctttgggagagactttgctg
taa

DBGET integrated database retrieval system