KEGG   Lachancea thermotolerans: KLTH0D09790gHelp
Entry
KLTH0D09790g      CDS       T01117                                 

Definition
KLTH0D09790p
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lth  Lachancea thermotolerans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    KLTH0D09790g
  Replication and repair
   03420 Nucleotide excision repair
    KLTH0D09790g
Transcription machinery [BR:lth03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     KLTH0D09790g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(808930..810450)
Genome map
AA seq 506 aa AA seqDB search
MSSTLFKATVTEYLQELPAQVHSRLYSSPATCLAIYRLLPKLAKFFIMSLVFNETDASLR
DLDRWVKSGGKYQFNEAIKSMKSLHLLIEGNSGQPFMINLNPIFRSSFRNALTGGEVNNS
FGNVVEDENETVHTSILDQYAANKWETILHFMVGTPLTQTPSRNVLSLLQHSKLMEESSS
GELQITNEGFQFLLQDANAQIWALLLQYLRLAETLQMDPVDVLNFIFMLGALELGKAYSD
TNLSDTQKIMLQDMRDYGLVFQKASNTHKFYPTRLTAMLTSDTSSIRSASGAMNSVLSQG
TSSSKEEAAAVAETDEETAQVGGTTQNIPDGAVILETNFKLYSYSNSPLQIAVLSLFVHL
KSRFSNMVTGQITRESIRRALHNGITADQIIAYMETHAHPQMRRLAEQTLDKKMELDPNC
NEGLQILPPTVVDQIKLWQLELDRIISYDGYLFTDFENFQEYNMLSSYAKDIGVLLWSDD
KKKRFFVSQEGNSQVIDYAKRKLKKK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcacgcttttcaaggccactgtgactgaatacctacaagaactaccagcgcag
gttcactcaaggctttacagctctcccgccacatgtttagcaatctataggctgcttcca
aagttggccaaattcttcatcatgtctctggtgttcaacgaaactgatgcatcgcttcga
gacctagacaggtgggttaagagtggcggaaagtatcagttcaacgaagcaatcaagtcg
atgaagtctctacatttgctaatagaagggaactctggccaacccttcatgatcaacctg
aacccaatatttaggagcagcttcagaaacgccttaaccggtggggaagtcaacaattca
tttggaaatgttgtcgaggatgaaaacgagactgttcatactagtatacttgatcagtat
gctgcaaataaatgggaaacaatattgcactttatggtgggtacgccactaacgcagacg
ccttccagaaacgttctttctttgctgcaacacagtaaactcatggaggaaagcagctct
ggagaacttcaaattaccaatgaaggctttcagtttttgctgcaggatgctaacgcccaa
atttgggctttgctacttcaatacctaaggctggcagaaactttacaaatggaccccgta
gatgtgctaaactttatttttatgcttggcgcccttgagttgggaaaggcatatagcgat
acaaacttgagtgatacccaaaaaatcatgctccaagacatgcgcgactacggccttgtt
ttccaaaaagcctctaatacacacaaattttatcccacaagactgacagctatgctgaca
tcagacacgtcaagtattcgtagcgcttcgggtgcaatgaacagcgtcttgagtcagggc
accagcagctctaaggaagaagctgccgctgtcgcagaaactgacgaagaaactgctcaa
gttggaggaactactcagaacatccccgatggggctgtcattttggagacgaacttcaag
ctctattcttattcaaactcgccgcttcaaattgctgttctgagcctctttgtacatttg
aagtccaggttcagcaacatggttacgggccagattacaagagagtctattagacgagca
ctgcacaacggtataacggctgaccagatcatagcttatatggaaactcacgctcatcca
cagatgaggagactggcggagcagacacttgacaaaaaaatggaactcgatccaaattgt
aatgaagggttgcagatcttgcccccgacggtagtggaccaaataaaattatggcagctg
gagcttgatagaattatcagctacgatggttaccttttcactgacttcgagaatttccaa
gagtataatatgctgagcagttatgcaaaagatattggcgtccttctgtggagtgatgat
aaaaagaagagattttttgtatctcaagaaggaaactctcaagtcatagactatgcaaag
cgtaaattaaagaagaaatag

DBGET integrated database retrieval system