KEGG   Lachancea thermotolerans: KLTH0D10802gHelp
Entry
KLTH0D10802g      CDS       T01117                                 

Definition
KLTH0D10802p
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lth  Lachancea thermotolerans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lth00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lth00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:885955..886668
Genome map
AA seq 237 aa AA seqDB search
MALNRPPIVTIVACLMPEMGIGYNGKLPWRLKQEMAYFRQVTSATFADGKRNAVIMGRKT
WESIPPKFRPLPDRVNVVVSRQFAEDLAPAQSSAPGSKLSSHAGAAAPASPALWLSNSLT
RCLDLLPQRVPDLERIYVIGGAEIYAQSNSLCDYMLITKIEPESATERPPMDAFLDTQSI
HALFQHDQSLPSFLPPAVSLPADPYISENGYRYNFALYRRRSEPKTDLKTKECAPQK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaacagaccgcccatcgtcactatcgtcgcgtgtctgatgcccgagatgggc
atcggctacaacggcaagcttccctggaggcttaagcaggagatggcctacttccggcag
gtcaccagcgcgaccttcgcagacggcaagcgcaatgcggtgatcatgggccgcaagacg
tgggagtcaataccgccaaaattcaggccgctcccggaccgcgtcaacgtcgttgtctca
cgtcagtttgcagaggatcttgcgcctgcgcagagcagcgcgcccggcagcaagctcagc
agccacgctggcgctgccgcgccggcgtcccccgcgctgtggctcagcaattcgctcacc
cgctgtctcgacctgcttccgcagcgcgtgccagaccttgagcgtatctacgtgattggc
ggcgccgagatctacgcccagagcaacagcctgtgtgactacatgctcatcaccaaaata
gaacccgaatccgcgaccgaaaggccgcccatggatgctttccttgacactcaatctatc
catgccctgttccagcacgaccaaagtttgccttccttcctaccgcccgccgtgagtctt
cccgcagacccctacatcagcgagaatggctatcgctacaatttcgcactttacaggcgc
cgcagtgaaccaaaaacagatctgaaaactaaagaatgtgcgcctcagaaatga

DBGET integrated database retrieval system