KEGG   Lachancea thermotolerans: KLTH0D11154gHelp
Entry
KLTH0D11154g      CDS       T01117                                 

Definition
KLTH0D11154p
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLTH0D11154g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:911708..913045
Genome map
AA seq 445 aa AA seqDB search
MSHDEEKKPVVPKEISDIGELNIGCKCWVDKDGEERLAEILSINKRKSPPKFYVHYEDFN
KRLDEWVLTPRINLGREVFFPQDEKDAKEAEKDKSSSKKQKQKKNTPASRSSSHSDAVDG
EDVMDLDNLNVQGIKDEDISRDDEIKKLRTSGSMVQNSHEVARVRNLNKIIMGKYEIEPW
YFSPYPIELTDEDVVYIDAFTLQYFGSKKQYERYRSKCTLRHPPGNEIYRDDYVSFFEID
GRKQRTWCRNLSLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESAEGY
NVACILTLPQYQRMGYGRLLIEFSYELSKKEGKAGSPEKPLSDLGLLSYRAYWADTLIKL
LMNHGTEITIDEISSMTSMTTTDILHTLKALNILQYYKGQHIIYMNEDVVQRYEKIKQKK
GRNIDPAKLIWKPPVFTASQLRFAW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagccatgatgaggaaaagaagcctgttgtaccaaaggagatatcagatattggagaa
ctgaacattggatgcaagtgttgggtcgacaaagatggagaggagaggctagcagagatc
ttgagtataaacaagagaaagagcccacctaagttttatgtacactatgaggacttcaac
aagcgtctagacgagtgggtgctgacgccgcggattaacctcggaagggaagtgtttttt
cctcaagacgaaaaggatgcaaaggaagcggagaaagataaatccagtagtaagaagcag
aaacagaagaagaacacaccagcaagtcgatcctcgtctcattctgatgcagtagacgga
gaagatgtcatggatcttgacaacttgaatgtgcaaggtatcaaggacgaggatatatca
cgagacgacgagatcaagaaacttagaacctcaggatccatggttcaaaattcacacgaa
gttgcgagagtcagaaatctgaacaaaataatcatggggaaatacgaaattgaaccttgg
tatttctcgccttatcccatcgagctcaccgatgaagatgtggtatacatcgacgcattt
actttacagtactttggttccaaaaagcagtatgaaagataccggtcaaaatgcacgctg
cggcatcctcccgggaacgagatttaccgtgatgactatgtgtcgtttttcgaaattgat
ggcaggaagcagagaacgtggtgccggaacctgtccttgctctcaaagctgtttttggac
cacaagactctttattacgacgtcgatccatttttattttattgcatgacgaggagagat
gaattaggacatcatttggttggttatttttccaaagagaaagaatcagcggaaggatac
aacgttgcgtgtattctgacacttccacagtatcaaagaatgggttacggaagactcttg
atcgagttttcctacgagctctcaaaaaaggaagggaaagcaggctctcccgagaagccc
ctctctgatttaggcctactatcatacagagcttattgggcagatacattaatcaagctc
cttatgaatcatggaacagaaataactattgatgaaataagctcaatgacctcaatgaca
acaacagacattctacacactctgaaggccctcaacattctacaatactataaaggacaa
cacatcatttacatgaatgaagatgttgtacaacgttacgagaaaattaaacagaaaaaa
ggccgtaatatcgatccagccaaacttatttggaaacctccagtgttcacagcttctcag
ctccgttttgcatggtag

DBGET integrated database retrieval system