KEGG   Lachancea thermotolerans: KLTH0D12760gHelp
Entry
KLTH0D12760g      CDS       T01117                                 

Definition
KLTH0D12760p
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1045108..1046469
Genome map
AA seq 453 aa AA seqDB search
MSCQHLDQIFRNEKTRDGVLRAYNMIRYIIEHSSFQNRHLHSMRCSECLEINCGSTFMCL
QCGVCGCWNKSHFALHSKKAGHIFGVNSSNGLLFCFKCGDYVGGNETLINSTLVKYWDDI
SVKSSLPVAKGRDGLCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHYSRCDIQDSSS
CFSCALDQIVMNFYGPTSDATFTSQQRGFVDLLLCSWKTNKNLAGYSQQDAHEFLQFFLN
QLHADHVRVAQTNVKAENCNCILHTAFQGSLRSSILCTDCQDGSNITFDPMMDLSLDIKN
KSTLVECLQSFHKGERLTDFNHHCSSCGSVQNPIKQMTIAKLPPVLVLQLKRFEHLMNGN
NVKLNGEITYPAYLNMAPFCHHSEARSVPDMVYELVAVISQEGSVNQGHYTCMCKVPGGQ
WFRFNDTMIVSITEEDVLRQQAYLLFYVIRQIG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtcagcatttggatcagatatttcggaatgaaaagactcgcgacggggtgctg
agggcctacaacatgattcgatacatcatcgagcacagcagcttccagaacaggcattta
cactcaatgagatgttctgaatgtctagaaattaattgtggatcaaccttcatgtgtctt
cagtgtggagtgtgtggttgctggaacaaaagccatttcgcacttcacagcaaaaaggcg
ggacatatttttggagtgaactctagcaacggccttctgttctgcttcaaatgtggcgat
tatgtgggcggcaacgaaacgctgatcaattctacgctcgtgaagtactgggacgacatc
tccgtgaaaagtagtttgcctgttgcaaaaggcagagacggtttgtgcggcctagtgaat
atggggtcaacctgtttcatgagcagcattattcagacgctagttcacaacccgtacgtc
cttaaacagtgtatgaaccagaatcattattctcgttgtgacatccaagacagctcatcg
tgcttttcctgcgctttggatcaaatcgtgatgaacttttatggcccaacctccgatgca
acgtttacttcgcaacaacgcggtttcgtagatttgctcctttgctcctggaagacgaac
aagaatttggcaggttactcgcagcaggacgctcacgagtttttgcagttctttctaaat
caactacacgcagaccatgtcagggtcgcacagaccaacgtaaaagcggaaaactgtaac
tgcattctacacactgcttttcaaggttctctcaggagctcaattctttgcacagactgc
caggatggcagtaacattacttttgacccaatgatggatctgtcactcgatataaaaaac
aaatcaacactggtggagtgtcttcagagctttcacaagggggaaagactcacggacttt
aatcatcattgttccagttgcggatccgtgcaaaatccaataaagcaaatgactatcgca
aagcttcctcctgtgttagttttgcagctaaaaaggtttgagcatcttatgaatggcaat
aacgtgaaacttaatggagaaataacatatcctgcatacctcaacatggcccccttttgt
catcatagcgaagctcgctcggtgccagatatggtgtacgaattggtagctgtgatctcg
caggagggctctgtgaaccaaggtcattacacgtgcatgtgtaaggtaccaggtggtcag
tggttccgattcaacgatacaatgatcgttagcattacagaagaagacgtccttcggcaa
caagcatatttacttttctacgtcatccgccaaatcggctag

DBGET integrated database retrieval system