KEGG   Lachancea thermotolerans: KLTH0D12760gHelp
Entry
KLTH0D12760g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D12760p
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLTH0D12760g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0D12760g
Transcription machinery [BR:lth03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     KLTH0D12760g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1045108..1046469
Genome map
AA seq 453 aa AA seqDB search
MSCQHLDQIFRNEKTRDGVLRAYNMIRYIIEHSSFQNRHLHSMRCSECLEINCGSTFMCL
QCGVCGCWNKSHFALHSKKAGHIFGVNSSNGLLFCFKCGDYVGGNETLINSTLVKYWDDI
SVKSSLPVAKGRDGLCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHYSRCDIQDSSS
CFSCALDQIVMNFYGPTSDATFTSQQRGFVDLLLCSWKTNKNLAGYSQQDAHEFLQFFLN
QLHADHVRVAQTNVKAENCNCILHTAFQGSLRSSILCTDCQDGSNITFDPMMDLSLDIKN
KSTLVECLQSFHKGERLTDFNHHCSSCGSVQNPIKQMTIAKLPPVLVLQLKRFEHLMNGN
NVKLNGEITYPAYLNMAPFCHHSEARSVPDMVYELVAVISQEGSVNQGHYTCMCKVPGGQ
WFRFNDTMIVSITEEDVLRQQAYLLFYVIRQIG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtcagcatttggatcagatatttcggaatgaaaagactcgcgacggggtgctg
agggcctacaacatgattcgatacatcatcgagcacagcagcttccagaacaggcattta
cactcaatgagatgttctgaatgtctagaaattaattgtggatcaaccttcatgtgtctt
cagtgtggagtgtgtggttgctggaacaaaagccatttcgcacttcacagcaaaaaggcg
ggacatatttttggagtgaactctagcaacggccttctgttctgcttcaaatgtggcgat
tatgtgggcggcaacgaaacgctgatcaattctacgctcgtgaagtactgggacgacatc
tccgtgaaaagtagtttgcctgttgcaaaaggcagagacggtttgtgcggcctagtgaat
atggggtcaacctgtttcatgagcagcattattcagacgctagttcacaacccgtacgtc
cttaaacagtgtatgaaccagaatcattattctcgttgtgacatccaagacagctcatcg
tgcttttcctgcgctttggatcaaatcgtgatgaacttttatggcccaacctccgatgca
acgtttacttcgcaacaacgcggtttcgtagatttgctcctttgctcctggaagacgaac
aagaatttggcaggttactcgcagcaggacgctcacgagtttttgcagttctttctaaat
caactacacgcagaccatgtcagggtcgcacagaccaacgtaaaagcggaaaactgtaac
tgcattctacacactgcttttcaaggttctctcaggagctcaattctttgcacagactgc
caggatggcagtaacattacttttgacccaatgatggatctgtcactcgatataaaaaac
aaatcaacactggtggagtgtcttcagagctttcacaagggggaaagactcacggacttt
aatcatcattgttccagttgcggatccgtgcaaaatccaataaagcaaatgactatcgca
aagcttcctcctgtgttagttttgcagctaaaaaggtttgagcatcttatgaatggcaat
aacgtgaaacttaatggagaaataacatatcctgcatacctcaacatggcccccttttgt
catcatagcgaagctcgctcggtgccagatatggtgtacgaattggtagctgtgatctcg
caggagggctctgtgaaccaaggtcattacacgtgcatgtgtaaggtaccaggtggtcag
tggttccgattcaacgatacaatgatcgttagcattacagaagaagacgtccttcggcaa
caagcatatttacttttctacgtcatccgccaaatcggctag

DBGET integrated database retrieval system