KEGG   Lachancea thermotolerans: KLTH0D12936gHelp
Entry
KLTH0D12936g      CDS       T01117                                 

Definition
KLTH0D12936p
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lth  Lachancea thermotolerans
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:lth04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1053567..1054502)
Genome map
AA seq 311 aa AA seqDB search
MLLQRLWLVFLGLCVVWAQNFYDNSPHIMELTPKSFDKVVHKTNYTTLVEFYAPWCGYCK
MLKPILQRAAKNLDGIVQVASVNCDLAKNKQLCAKYRVEGFPILMVFRPPKVDLSKKGKD
RLKLGNHASEVYKGERKLRPIVDFSISRVKNYITRITRLEKLVQHLNRNNEVRYKAVLFS
KKDKISPLYKSLALDWLGSVDFSLFLNSKLSTTPEALRDLHPEFQNFLSELRENANDLEK
SMLVLFDTQDHRYYIYEEESFEKVNIWKLLSKFASPNEGPFTKRQDFLDALKSNKKTRKP
PAKQKLEHDEL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgcaacgactatggttggttttcttgggactatgcgtcgtgtgggcgcagaac
ttttacgacaattccccacacattatggaattgacacctaagagctttgacaaggttgtt
cacaagaccaactacacaacgttggtagagttctatgctccgtggtgtggttactgcaag
atgctcaaacctattttgcagcgagccgctaaaaatctcgacggcatcgtccaggtagca
agtgtgaactgcgacctggcaaaaaacaagcagttgtgtgcgaaataccgcgtcgaaggc
tttccaatcttgatggtgtttaggccgcccaaagtcgatctcagtaagaaaggaaaggac
cgactaaaacttggaaatcacgccagtgaggtctacaagggcgagcgtaaactacggcct
atagtagattttagcatatccagggtcaagaactacatcactcgcataaccaggctagag
aagttagttcagcacttgaaccgcaataacgaggtgcgctataaagcggttttattctca
aaaaaggacaagatatccccgctctacaaaagtctggcactggactggctgggttccgtc
gacttcagcctatttctgaactctaagctcagcaccacgccggaagcactgcgggatttg
catcctgaattccaaaacttccttagtgagttacgagaaaatgcgaatgaccttgaaaag
agcatgctagtgctctttgacactcaagatcataggtactacatttacgaggaagaatcc
tttgagaaagttaatatctggaaactactctcgaagtttgcctcccctaatgaaggccca
tttactaagcgccaggactttctagatgccttgaaatcgaacaagaaaactcggaagcca
cctgcgaaacaaaagctagagcacgacgagttatga

DBGET integrated database retrieval system