KEGG   Lachancea thermotolerans: KLTH0D16060gHelp
Entry
KLTH0D16060g      CDS       T01117                                 

Definition
KLTH0D16060p
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
lth  Lachancea thermotolerans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KLTH0D16060g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KLTH0D16060g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1328913..1333556
Genome map
AA seq 1547 aa AA seqDB search
MNNSSASGSLLANDLTINSTGLTVAGDNVIEGLTTAFNLLTQASSSILAVCGAIFTSTTW
HVMRFFLLRVPSWVVVSSSVSITLSFYTLLLVLFTIMFATYYVLSGRFLHAYKRLQPDDS
DEKLLKDKKFRDETEALFANKSESQRKGGFTSYLDEFLSAIKIFGYLEKPVFHELTKSMK
TRRLEEGEVLLVDDALGFAIVVEGSLQTYHKVQRTNKNLTGSVPDFLDGSNSDSLDDAAS
DCDAYSLNGEKYQLLNIVRAGNPVSSLVSILRLFTGRNDTPLSNSIPSFPASEEGYPGFM
SPFLDSTLENHASELRNTSRTQKLAQEQLDSGPRSPNTENIRGETKDRPENTVPFEGSLP
DIIACAPGDCTIAIIPASAFRRLTSKFPRSASHIIQMVLTKLYRVTFQTAHTYLGLTKEI
INTEVVLNRSNNIELPYYLKEAAIRKIKAQELFKKEEQLKTPKTGPKTRTPIGRRSSKGR
ASPHSFLKNRGSRHVVLDSRDHLNPGDLLSNVPLSRKDTPTIRGVSNNSVYQSESAKSKS
FRNSNNQVNAQLSSLSSLSDKAKAINKSGKSSALSAATNEDDEIRERTFSAAQEETEESS
WRIALVEGMFSYLGITKENILPTTDDDDDALSLRRSSEVSLTPSSQMSAPSAFRLLSPDQ
FVTKKGPKVKPKQEYKEEIPYNIDFDTVKDEFAQGLQTMFVREGSILVSQNTHNKGLYYI
ISGTMEVIWTNEEDHTQHILHNIKSGGIAGYLASLIGSKSFVTLRAKTDLYVGFLPVPTL
ERLCDKYFMIYLRIAETLINLLNPKILKLDYALEWIHLDASEILFNQDEPANAIYVVLSG
RLRQLHRSNKTKPEALERKNKKRHLRDSSKVRAIREYAQGESLGEVDVLTAINRLSTVVA
LRDTELARIPRTLFELLAMEHPSIMIRVSRLVARKILQQQRGSEAPESINSAKDYKYDFN
LLIPPTETTKGSVINSEHGASAPSDGDSRHSYRTITILPITQGLPVEEFASKLVTAFKQV
GMSTIGLNQSATLSHLGRHAFDGLSKLKQSGYFAELEEIYDTVVYIADTPTNSSWTTTCI
NQGDCILLLAHSAMTPDIGEFERLLIKSKSNARIELILLHAERYVEPGLTHKWLKNRMWV
HSHHHMQFSSPSYVRDKEPEAEPESNTKTFIRNLKRERLNHITRQTQENISRLLPDSLKS
TVENFSSKFINKKSQFYTPVLSHKNDFLRLARILSGKAIGLVLGGGGARGISHLGVLRAI
EEHGIPIDMIGGTSIGAFVGGLYAKDYDLVPIYGRMKKFAGRVGSVWRLLTDLTWPVTSY
TTGHEFNRGIWKTFGDIRIEDFWIQYYCNSTNITESIQEIHSTGYAWRYIRASMSLAGLL
PPIEDNGSMLLDGGYVDNLPVWEMKARGCNTIFAVDVGSVDDRTPQRYGDSLNGFWIVFN
RWNPFSDYPNIPNMTEIQMRLGYVASVNALEKAKNTPGVIYARPPIEDYATLDFAKFEEI
YQVGTAYGHDFFQELEKQKKMPHIPGSEMLADDPESRHRMLYRRNSV
NT seq 4644 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagtagcgcttcaggctcactactggcaaatgacctaaccatcaactctaca
gggttaacagtcgcaggtgacaatgtcattgaaggtcttactaccgcttttaacttgttg
acgcaggcgtcttcatcgattctggcggtctgcggagccatctttaccagcactacttgg
cacgtcatgcgcttctttctcctgcgagtaccctcttgggtcgtcgtatcttccagcgtt
agtattaccctttcattctacactctgctcttagtactgtttaccataatgtttgccaca
tactacgtgctaagtggccgatttttgcatgcctacaagcggctacaacctgatgacagc
gatgagaagctgctcaaagacaagaagtttcgtgatgagacggaggcacttttcgccaac
aagtctgaaagccagcggaaaggcgggttcacgtcgtacctggatgaatttcttagcgcc
atcaaaatttttggttacctcgagaagcctgtatttcatgaactgaccaagtctatgaag
acccgtaggcttgaagaaggagaggttctacttgttgacgatgcccttggctttgccatt
gttgttgaaggaagccttcaaacttaccataaggttcaacgcaccaacaaaaatctgacg
ggtagtgttcctgattttctagacggaagcaactccgactcacttgacgatgctgcctca
gactgtgacgcttactcgctgaacggtgaaaaataccaactcttgaacatcgtgagagcc
ggcaacccagtttcatcgttagtgagtattttaaggcttttcaccggacgcaatgacact
ccactaagtaactcaattcccagttttccagcatccgaagagggctatccaggctttatg
tcaccctttctagattcaaccttagagaatcatgcgtctgaactaagaaatacctctaga
acgcaaaagcttgcgcaagagcagctagactctggcccacgttcgcctaacaccgaaaat
attcgaggtgaaactaaagatagaccggagaatacggtaccatttgaaggctcgttgccc
gatattatcgcctgcgcacctggggactgcactatcgccataattcctgcatccgctttc
cgcaggctgacttcaaagttcccccgctctgcatctcatatcatacagatggtactaaca
aagctttacagagtgacatttcagacggctcatacttacttagggctcactaaagagata
atcaacactgaagttgtattaaacagatctaacaacatcgagcttccatactacctgaaa
gaggctgcgatccgaaagataaaagctcaggaactgtttaaaaaagaggagcagttaaaa
accccgaaaactggtccaaagacgagaactccaattggtaggcgctcttctaagggacgc
gcatctcctcactcctttctcaaaaatcgcggctcccgacatgtagtgctggattctaga
gatcacctgaaccctggtgatttactttcaaatgttcccttgtcgcggaaggacactcct
acgataagaggggtgtccaataactctgtttaccaaagtgaaagcgcgaaatctaaaagt
ttcaggaactctaacaatcaggtcaacgcccagctttcttccttgtcttccctatctgac
aaagcgaaggcaataaacaagagtgggaagagcagcgcactaagcgccgctaccaacgag
gatgacgaaattagggaaaggactttctctgccgctcaagaggaaacagaagagtcatct
tggagaatcgctttagttgaaggaatgttttcttaccttggcataacaaaggaaaacata
cttcctacgacggatgatgacgacgatgcgctctcgttgcgtaggtcctcggaagtgtcc
ttgacaccatcatctcagatgagtgctccatcagccttccgtttgttgtctccagatcag
tttgtaacaaagaaaggacctaaggttaaaccaaagcaggaatacaaagaagaaatacca
tacaatattgattttgacacagtcaaagatgagtttgctcaaggtctacaaacaatgttt
gtacgcgaaggttctattttggtttcacagaacactcacaacaaaggcctatactacatt
atatcaggcactatggaggttatttggacgaatgaagaagaccacacgcagcacattctg
cataatataaagtccggcggaatagctggttacttggcttctttgataggaagcaagtcc
ttcgtcactcttagagcaaagaccgatttgtatgttggatttctgccagttcccactttg
gaaaggctctgcgacaaatattttatgatatatttacggattgccgagaccttgatcaat
ctcttaaatcctaaaatactaaaattggactacgctctagaatggatacatttagatgca
tcagagattctcttcaaccaagatgagcctgctaacgcaatttacgtcgttttgagcggc
agacttcgtcaacttcatcgttcgaataagacaaaacccgaagctctagagaggaaaaac
aaaaaaagacacttgcgcgatagctctaaagtcagggcgattagagaatatgcccagggt
gagagcttaggggaagttgatgtgttaaccgcaataaatcgcctttccactgtcgttgct
ttgagagacacggagctggctcgtattcctagaacactgtttgagcttcttgcaatggag
catccctcgataatgattcgagtaagcagactagtcgcaaggaaaattctccagcaacag
agaggatcggaagcccctgaatccataaacagcgcgaaagactacaagtatgatttcaac
cttctcattcctcccacagaaacaacgaagggttctgtcataaactctgaacatggcgct
agtgctccttcagatggcgacagcagacatagttatcgcacaataaccatccttccaatc
acccagggtctcccagtcgaagaatttgcctcgaaattggtaaccgcttttaaacaggtg
ggaatgtctacaattggacttaaccaatctgcgactttgtctcatttagggcgtcatgcc
ttcgacgggctctctaaattaaagcagtctggatactttgctgagcttgaagagatctac
gatactgtcgtctacattgcagacacgcccacgaactcttcctggactacgacctgtatc
aaccaaggagactgtattttgttgctagctcattcagcaatgacaccggatatcggcgag
ttcgagcggctgttaatcaagtcaaaatctaatgctagaatcgaattgatacttttgcac
gcagagcgctacgttgagcctggacttacccacaagtggttaaagaacaggatgtgggtc
cattctcatcaccacatgcagttttccagtccatcgtatgttagggacaaggaacctgaa
gctgagcccgaatcaaatacaaaaactttcatccgtaatttgaaaagagaacgcctaaat
cacatcactagacagacccaggaaaacatttctaggttactgcctgattcgctcaaatca
accgtcgagaacttttcctcaaagtttatcaacaagaagtcccagttttacacgccagtt
ttatcgcacaaaaatgattttctaagacttgctcgtatcctttctggcaaagctatcggg
ctagttttaggaggtggcggtgctagaggcattagccacttgggcgtgctcagagcgatt
gaggagcatggaatccctattgatatgattggtggcacttcgattggagcattcgtgggt
ggtctttacgcgaaagactacgacctggtgccaatctacgggcgcatgaagaaatttgct
ggcagagttggctccgtatggagacttctgacagacttgacttggcctgtgacctcttac
accacgggccacgaatttaacaggggcatatggaagactttcggggacatccgtatcgaa
gatttctggatacaatactactgcaactctacaaacatcacggagtccattcaagagata
cactcaactggctatgcttggagatatattcgtgcatcaatgtcactagctgggcttttg
ccaccaatcgaagacaatggctccatgttgctcgatggcggctacgtcgataacctgcca
gtgtgggaaatgaaggcccggggatgcaatacaatttttgcagtggacgtcggatctgtc
gacgacagaacaccccaaagatacggcgactctttaaatggattctggatcgtgttcaac
agatggaatcccttttctgattacccaaacattccaaatatgacagagattcaaatgcgc
ctgggctatgtcgcatcggtcaacgcattggagaaggctaaaaacacacccggcgtcatt
tacgccagaccaccaatcgaagactacgcgactctggatttcgccaagtttgaggagatt
tatcaggtaggaaccgcctacggtcacgatttctttcaagaacttgagaaacaaaaaaag
atgccccacatcccaggctccgagatgttagcggacgatccggaatcgcgccatcgcatg
ctatatagacgcaacagcgtgtaa

DBGET integrated database retrieval system