KEGG   Lachancea thermotolerans: KLTH0E02024gHelp
Entry
KLTH0E02024g      CDS       T01117                                 

Definition
KLTH0E02024p
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLTH0E02024g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   KLTH0E02024g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:185547..186506
Genome map
AA seq 319 aa AA seqDB search
MSWNTIESDAGVFTQLIRDLGVSGVQFAEIPMLDSLEELAPSLYGVIFLFKYNSSDYAGN
EPVQGAYDFDYPDSLFFANQTIQNACGTLAVLNTLLSLSNDFPEEIRLGDTLSEFISFTA
AFKDPVLRGESVSNSDHIRNVHNSFSTPEPFVLDEKTPDDGRKAAEVFHFVSFVEHEGVL
YELDGLRPTPIVHREYSNDSRDRLTFAQNIISVLQKRMQLCVNSGGKFSVIAIHRDAIER
LEDLRQQGAITDQDYQLECSRELQKRETWAKELSMRRQNLYGLIFELLKQVSSSMTDEEF
ADHIKIAQKTTLERLKRRN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggaataccattgagtcagatgctggtgtattcacacaacttatccgtgatctt
ggtgtgtcaggcgttcagtttgcggagattcctatgctggactctctggaggagttagca
ccatcgctttacggcgtcattttcctgtttaaatataactcatcagattacgccggaaac
gagccagtgcaaggagcttacgacttcgattacccagactcgttgtttttcgctaatcaa
accatccaaaacgcatgtggaaccctagcggtgctgaatacccttctttcgctatccaat
gacttcccagaagagatcagattgggtgatacgctctctgagtttattagcttcacggct
gcattcaaggatcctgtattacgcggtgagagtgtttcgaattctgatcatattcgtaat
gtgcacaactcgttttccactcctgagccgtttgtcctcgatgagaaaaccccagatgac
ggacgtaaggctgccgaggtatttcatttcgttagttttgtagagcacgaaggtgttctt
tatgaactggacgggcttcgtccaacacctatagttcaccgcgagtatagtaatgactca
cgcgacaggctcacatttgcccagaacatcatttccgttctccaaaaaaggatgcaatta
tgcgtgaattccggtgggaagttttccgtcatagctatccatagggatgcaattgaacgc
ctggaagacctgcgtcagcaaggagctattactgaccaagactatcaacttgaatgcagc
agagaactacaaaaacgcgagacctgggcaaaggagctctcaatgaggcgacaaaatttg
tatggtttgatcttcgagcttctcaaacaggtcagcagttcgatgaccgacgaggaattc
gctgatcacatcaaaatagctcaaaaaactaccttggaaagactcaaacggcgcaattga

DBGET integrated database retrieval system